SitesBLAST
Comparing 6937232 FitnessBrowser__SB2B:6937232 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ns8A Crystal structure of beta-glucosidase bglm-g1 mutant h75r from marine metagenome in complex with inhibitor 1-deoxynojirimycin (see paper)
51% identity, 93% coverage: 20:440/452 of query aligns to 9:434/440 of 5ns8A
6z1mA Structure of an ancestral glycosidase (family 1) bound to heme (see paper)
49% identity, 94% coverage: 18:443/452 of query aligns to 5:418/423 of 6z1mA
- binding protoporphyrin ix containing fe: P164 (= P174), N165 (≠ F175), L194 (= L204), L195 (= L205), L218 (= L228), L220 (≠ F230), N244 (= N254), F247 (≠ Y257), K253 (≠ E263), Y256 (= Y266), L288 (≠ I293), R318 (≠ G342), Y323 (≠ F347)
- binding magnesium ion: H346 (= H371), K409 (≠ S434)
4hz7A Crystal structure of bglb with glucose (see paper)
47% identity, 94% coverage: 20:444/452 of query aligns to 7:436/441 of 4hz7A
- active site: R74 (= R85), H118 (= H128), E163 (= E173), V166 (≠ C176), N290 (= N299), Y292 (= Y301), E347 (= E356)
- binding beta-D-glucopyranose: Q17 (= Q30), H118 (= H128), E163 (= E173), Y292 (= Y301), E347 (= E356), W394 (= W402), E401 (= E409), W402 (= W410), F410 (= F418)
4ptwA Halothermothrix orenii beta-glucosidase a, 2-deoxy-2-fluoro-glucose complex (see paper)
45% identity, 96% coverage: 14:447/452 of query aligns to 1:444/445 of 4ptwA
- active site: R74 (= R85), H118 (= H128), E163 (= E173), V166 (≠ C176), N291 (= N299), Y293 (= Y301), E351 (= E356)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q17 (= Q30), H118 (= H128), E163 (= E173), Y293 (= Y301), E351 (= E356), W398 (= W402), E405 (= E409), W406 (= W410)
4ptvA Halothermothrix orenii beta-glucosidase a, thiocellobiose complex (see paper)
45% identity, 96% coverage: 14:447/452 of query aligns to 1:444/445 of 4ptvA
- active site: R74 (= R85), H118 (= H128), E163 (= E173), V166 (≠ C176), N291 (= N299), Y293 (= Y301), E351 (= E356)
- binding beta-D-glucopyranose: W324 (= W329), E405 (= E409), Y408 (≠ E412)
- binding 4-thio-beta-D-glucopyranose: Q17 (= Q30), H118 (= H128), E163 (= E173), Y293 (= Y301), E351 (= E356), W398 (= W402), E405 (= E409), W406 (= W410)
7wdoA Crystal structures of mebgld2 in complex with various saccharides
48% identity, 93% coverage: 19:439/452 of query aligns to 8:435/445 of 7wdoA
- binding beta-D-glucopyranose: Q19 (= Q30), H120 (= H128), W121 (= W129), N164 (= N172), E165 (= E173), E165 (= E173), N222 (= N229), N224 (≠ S231), Y294 (= Y301), E351 (= E356), W398 (= W402), E405 (= E409), W406 (= W410), F414 (= F418)
7wdsA Crystal structures of mebgld2 in complex with various saccharides
48% identity, 93% coverage: 19:439/452 of query aligns to 8:435/444 of 7wdsA
- binding beta-D-xylopyranose: Q19 (= Q30), H120 (= H128), E165 (= E173), L172 (= L180), Y294 (= Y301), W324 (= W329), E351 (= E356), W398 (= W402), E405 (= E409), W406 (= W410), R408 (≠ E412)
7wdnA Crystal structures of mebgld2 in complex with various saccharides (see paper)
48% identity, 93% coverage: 19:439/452 of query aligns to 8:435/444 of 7wdnA
- binding alpha-D-glucopyranose: Q19 (= Q30), E25 (≠ D34), D35 (= D44), H120 (= H128), E165 (= E173), E165 (= E173), K186 (≠ R194), N222 (= N229), F246 (≠ H253), W266 (≠ L273), Y267 (≠ E274), Y294 (= Y301), P306 (≠ G313), M307 (≠ F314), W324 (= W329), E351 (= E356), W398 (= W402), E405 (= E409), W406 (= W410), F414 (= F418)
7wdrA Crystal structures of mebgld2 in complex with various saccharides
48% identity, 93% coverage: 19:439/452 of query aligns to 8:435/445 of 7wdrA
- binding 4-nitrophenyl beta-D-glucopyranoside: Q19 (= Q30), H120 (= H128), E165 (= E173), W167 (≠ F175), N222 (= N229), L223 (≠ F230), N224 (≠ S231), F246 (≠ H253), Y294 (= Y301), A295 (≠ T302), R296 (= R303), T297 (≠ N304), F312 (≠ I319), W324 (= W329), W324 (= W329), E325 (= E330), W398 (= W402), E405 (= E409), W406 (= W410)
6m6lB The crystal structure of glycosidase hydrolyzing notoginsenoside
46% identity, 96% coverage: 16:448/452 of query aligns to 6:445/445 of 6m6lB
1oinA Family 1 b-glucosidase from thermotoga maritima (see paper)
45% identity, 94% coverage: 20:443/452 of query aligns to 9:436/442 of 1oinA
- active site: R76 (= R85), H120 (= H128), E165 (= E173), V168 (≠ C176), N292 (= N299), Y294 (= Y301), E348 (= E356)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q30), H120 (= H128), N164 (= N172), E165 (= E173), Y294 (= Y301), E348 (= E356), W395 (= W402), E402 (= E409), W403 (= W410)
2j75A Beta-glucosidase from thermotoga maritima in complex with noeuromycin (see paper)
45% identity, 94% coverage: 20:443/452 of query aligns to 8:432/438 of 2j75A
- active site: R75 (= R85), H119 (= H128), E164 (= E173), V167 (≠ C176), N288 (= N299), Y290 (= Y301), E344 (= E356)
- binding (2r,3s,4r,5r)-5-(hydroxymethyl)piperidine-2,3,4-triol: Q18 (= Q30), H119 (= H128), N163 (= N172), E164 (= E173), Y290 (= Y301), E344 (= E356), W391 (= W402), E398 (= E409), W399 (= W410), F407 (= F418)
6rjmB Complex structure of virulence factor sgha and its hydrolysis product glucose (see paper)
46% identity, 94% coverage: 19:442/452 of query aligns to 13:444/456 of 6rjmB
- binding alpha-D-glucopyranose: Q24 (= Q30), H125 (= H128), N169 (= N172), E170 (= E173), Y298 (= Y301), W331 (= W329), E358 (= E356), W404 (= W402), E411 (= E409), W412 (= W410), F420 (= F418)
2cesA Beta-glucosidase from thermotoga maritima in complex with glucoimidazole (see paper)
45% identity, 94% coverage: 20:443/452 of query aligns to 8:434/440 of 2cesA
- active site: R75 (= R85), H119 (= H128), E164 (= E173), V167 (≠ C176), N291 (= N299), Y293 (= Y301), E346 (= E356)
- binding glucoimidazole: Q18 (= Q30), H119 (= H128), N163 (= N172), E164 (= E173), Y293 (= Y301), E346 (= E356), W393 (= W402), E400 (= E409), W401 (= W410), F409 (= F418)
2wc3A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine (see paper)
45% identity, 94% coverage: 20:443/452 of query aligns to 9:436/442 of 2wc3A
- active site: R76 (= R85), H120 (= H128), E165 (= E173), V168 (≠ C176), N292 (= N299), Y294 (= Y301), E348 (= E356)
- binding (3Z,5S,6R,7S,8S,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q19 (= Q30), H120 (= H128), N164 (= N172), E165 (= E173), Y294 (= Y301), H297 (≠ N304), W321 (= W329), E348 (= E356), W395 (= W402), E402 (= E409), W403 (= W410), F411 (= F418)
5ossB Beta-glucosidase from thermotoga maritima in complex with gluco-1h- imidazole (see paper)
45% identity, 94% coverage: 20:443/452 of query aligns to 8:437/443 of 5ossB
- active site: R75 (= R85), H119 (= H128), E164 (= E173), V167 (≠ C176), N291 (= N299), Y293 (= Y301), E349 (= E356)
- binding (4~{S},5~{S},6~{R},7~{R})-7-(hydroxymethyl)-4,5,6,7-tetrahydro-1~{H}-benzimidazole-4,5,6-triol: Q18 (= Q30), H119 (= H128), E164 (= E173), Y293 (= Y301), E349 (= E356), W396 (= W402), E403 (= E409), W404 (= W410), F412 (= F418)
5n6tA Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic (see paper)
45% identity, 94% coverage: 20:443/452 of query aligns to 8:437/443 of 5n6tA
- active site: R75 (= R85), H119 (= H128), E164 (= E173), V167 (≠ C176), N291 (= N299), Y293 (= Y301), E349 (= E356)
- binding [(1~{R},2~{R},3~{R},4~{S},5~{R},6~{S})-3,4,5-tris(oxidanyl)-7-oxabicyclo[4.1.0]heptan-2-yl]methanediazonium: Q18 (= Q30), H119 (= H128), N163 (= N172), E164 (= E173), Y293 (= Y301), E349 (= E356), W396 (= W402), E403 (= E409), W404 (= W410), F412 (= F418)
5n6sA Thermotoga maritima family 1 glycoside hydrolase complexed with carba- cyclophellitol transition state mimic (see paper)
45% identity, 94% coverage: 20:443/452 of query aligns to 8:437/443 of 5n6sA
- active site: R75 (= R85), H119 (= H128), E164 (= E173), V167 (≠ C176), N291 (= N299), Y293 (= Y301), E349 (= E356)
- binding azanylidene-[4-[[(1~{S},2~{R},3~{R},4~{R},5~{S},6~{S},7~{S})-2-(hydroxymethyl)-3,4,5-tris(oxidanyl)-7-bicyclo[4.1.0]heptanyl]carbonylamino]butylimino]azanium: Q18 (= Q30), H119 (= H128), W120 (= W129), N163 (= N172), E164 (= E173), W166 (≠ F175), V167 (≠ C176), E349 (= E356), W396 (= W402), E403 (= E409), W404 (= W410), F412 (= F418)
2wc4A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine (see paper)
45% identity, 94% coverage: 20:443/452 of query aligns to 8:437/443 of 2wc4A
- active site: R75 (= R85), H119 (= H128), E164 (= E173), V167 (≠ C176), N291 (= N299), Y293 (= Y301), E349 (= E356)
- binding (3Z,5S,6R,7S,8R,8aS)-3-(octylimino)hexahydro[1,3]thiazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q18 (= Q30), H119 (= H128), N163 (= N172), E164 (= E173), Y293 (= Y301), W322 (= W329), E349 (= E356), W396 (= W402), E403 (= E409), W404 (= W410), F412 (= F418)
2wbgA Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine (see paper)
45% identity, 94% coverage: 20:443/452 of query aligns to 8:437/443 of 2wbgA
- active site: R75 (= R85), H119 (= H128), E164 (= E173), V167 (≠ C176), N291 (= N299), Y293 (= Y301), E349 (= E356)
- binding (3Z,5S,6R,7S,8R,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q18 (= Q30), H119 (= H128), N163 (= N172), E164 (= E173), Y293 (= Y301), H296 (≠ N304), W322 (= W329), E349 (= E356), W396 (= W402), E403 (= E409), W404 (= W410)
Query Sequence
>6937232 FitnessBrowser__SB2B:6937232
MTTLSHFTLPGDSVMMQKDFLFGVATASFQIEGDAEHRQPCIWDTFCDTPGKIADGSNGQ
VACDHVKLWRDDVDLIASLGVDAYRLSISWGRVLHPDGSVNQRGMDFYINLLDELGRRGI
NVFVTLYHWDLPQHLEDKGGWLNRDTAVAFANYAAIVANALGNRVYAYSTLNEPFCSAFL
GYEAGIHAPGHKSRQQGRTAAHNLLLAHGMAMTEIRREAPEAKAGIVLNFSPAYPYTSSA
GDANAARLAHEYHNTWYLMPLMEGRYPDIINQLEPHERPVVEPGDMDIISTPIDYLGINY
YTRNVYRAGGPLGFEEVRIDNVPRTAMDWEICPQAFTDLLTGLAQEFNLPPIYITENGAA
EDDAPFNGTVHDPMRLDYLQSHLLAVHQAIERGVDIKGYFAWSLMDNFEWAEGYRKRFGL
VYVDYGTQQRILKSSAKAYQGMLAIRQEASQQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory