Comparing 6937234 FitnessBrowser__SB2B:6937234 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ut0A Crystal structure of exo-1,3/1,4-beta-glucanase (exop) from pseudoalteromonas sp. Bb1 (see paper)
48% identity, 93% coverage: 40:837/859 of query aligns to 4:803/804 of 3ut0A
3wlpA Crystal structure analysis of plant exohydrolase (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 12:602/602 of 3wlpA
3wljA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 3-deoxy-glucose (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 12:602/602 of 3wljA
1x39A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 12:602/602 of 1x39A
1x38A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 12:602/602 of 1x38A
1lq2A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 12:602/602 of 1lq2A
1j8vA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 4'-nitrophenyl 3i-thiolaminaritrioside (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 12:602/602 of 1j8vA
1iewA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 2-deoxy-2-fluoro-alpha-d-glucoside (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 12:602/602 of 1iewA
1ievA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with cyclohexitol (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 12:602/602 of 1ievA
1ex1A Beta-d-glucan exohydrolase from barley (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 12:602/602 of 1ex1A
6jg1A Crystal structure of barley exohydrolasei wildtype in complex with 4i, 4iii,4v-s-trithiocellohexaose (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 16:606/606 of 6jg1A
6jgaA Crystal structure of barley exohydrolasei w286f in complex with 4'- nitrophenyl thiolaminaribioside (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 16:606/606 of 6jgaA
6jg7A Crystal structure of barley exohydrolasei w286f in complex with methyl 2-thio-beta-sophoroside (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 16:606/606 of 6jg7A
6jg2A Crystal structure of barley exohydrolasei wildtype in complex with 4'- nitrophenyl thiolaminaribioside (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 14:603/603 of 6jg2A
6jg6A Crystal structure of barley exohydrolasei w286a mutant in complex with methyl 6-thio-beta-gentiobioside (see paper)
40% identity, 71% coverage: 53:661/859 of query aligns to 16:606/606 of 6jg6A
5m6gA Crystal structure glucan 1,4-beta-glucosidase from saccharopolyspora erythraea
41% identity, 70% coverage: 53:656/859 of query aligns to 11:578/579 of 5m6gA
5jp0A Bacteroides ovatus xyloglucan pul gh3b with bound glucose (see paper)
31% identity, 67% coverage: 48:624/859 of query aligns to 5:592/745 of 5jp0A
Sites not aligning to the query:
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
30% identity, 66% coverage: 52:622/859 of query aligns to 2:568/733 of 5tf0A
Sites not aligning to the query:
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
29% identity, 64% coverage: 57:608/859 of query aligns to 6:559/742 of 3u48B
Sites not aligning to the query:
5z9sA Functional and structural characterization of a beta-glucosidase involved in saponin metabolism from intestinal bacteria (see paper)
29% identity, 66% coverage: 56:624/859 of query aligns to 4:602/765 of 5z9sA
>6937234 FitnessBrowser__SB2B:6937234
MKFALSKTTLALACVLGGVMSGKVSAAESSSLTERDVNRWPEAVYHTPIQADVEAKVHKL
LAAMTLEQKVAQIIQPEIRDFGVEDMRRYGFGSFLNGGGSFPGNNNRAKAADWVALADQM
YHAAMDDSIDGIAIPPMWGTDAVHGHGNVFGATLFPHNIGLGATQNPQLIKAIAAATAKE
VRATGIDWVFAPTVALVDNLRWGRTYEGYARDPELIERYAEAFVDGMQGEGKSWLGDDYT
LATAKHFIGDGGTDNGDDRGDTRVDENTLIARHGQGYVGALGHGVQTVMASFNSWNGEKL
HGSKYLLTDVLKERMGFDGVVVGDWLGHGFVPGCSYEHCAEAVNAGVDILMAPGDSWKAL
YANTIADVKSGVLPLSRLDDAVKRVLRVKLRAGLFDNKAPSANPYAGKQEWIGHPEHRAI
ARQAVAESLVLLKNNRPANGARPVLPIAANARVLVVGEGADSIPQQSGGWSMTWQGTEVT
NADFPGATSIFAGIKAALNAAGGDALLSSDGTIPVGFKPDVVIAVYGEQPYAEGNGDLDN
LEYQRGDKRSLAMLSALKATGLPLVSVVLSGRPLWMNPEINVSDAFVAAWLPGSEGAGVA
DVLIGDKNAQPRADFKGRMPFPWPATPSADGFVSDTGSAGQDQPKPLFSLWQGFDYRSDA
TLAALSEDNGSSEADNRLAIFDKAIKAPWHLAVGDDKGLHRVGPGLWQQGPWAVRSVNRI
VQEDARRFEFGAAGTLSFRDDFTLDLRRFAPDSSLLSFDIALTALPGKLQLSMVCEGGCR
QAVELSGQLKADGQWQRVEVPLSCFGVTADELARTFSPMTMSLPQGGTLTLANVSLEGMV
QRDASAKAVECGLPPVSDK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory