Comparing 6937240 FitnessBrowser__SB2B:6937240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
60% identity, 92% coverage: 24:272/272 of query aligns to 9:257/257 of P0AAH0
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
35% identity, 89% coverage: 26:268/272 of query aligns to 4:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
35% identity, 89% coverage: 26:268/272 of query aligns to 4:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
35% identity, 89% coverage: 26:268/272 of query aligns to 4:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
35% identity, 89% coverage: 26:268/272 of query aligns to 4:239/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 89% coverage: 26:267/272 of query aligns to 3:236/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 86% coverage: 34:268/272 of query aligns to 10:237/240 of 4ymuJ
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
34% identity, 85% coverage: 36:267/272 of query aligns to 37:259/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
34% identity, 85% coverage: 36:267/272 of query aligns to 37:259/382 of 7aheC
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 86% coverage: 33:267/272 of query aligns to 11:241/343 of P30750
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
33% identity, 85% coverage: 36:267/272 of query aligns to 37:259/260 of 7ahdC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 86% coverage: 33:267/272 of query aligns to 12:242/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 86% coverage: 33:267/272 of query aligns to 12:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 86% coverage: 33:267/272 of query aligns to 12:242/344 of 3tuiC
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
32% identity, 85% coverage: 25:255/272 of query aligns to 2:233/280 of Q5M244
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 91% coverage: 22:269/272 of query aligns to 3:255/258 of P02915
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
30% identity, 90% coverage: 24:267/272 of query aligns to 1:233/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
30% identity, 90% coverage: 24:267/272 of query aligns to 1:233/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
30% identity, 90% coverage: 24:267/272 of query aligns to 1:233/371 of 3puwA
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
30% identity, 90% coverage: 24:267/272 of query aligns to 1:233/371 of 3puvA
>6937240 FitnessBrowser__SB2B:6937240
MISIDSTVMKTETLDLANLPASETALEIQNLNLHYGTKQALFDVSMKIPKKRVTAFIGPS
GCGKSTLLRCINRMNDLVDNCNITGEIRLHEQNIYDKAVDVAALRRNVGMVFQRPNPFPK
SIYENVVYGLRLQGINNRRELDEACERSLRGAAIWDEVKDRLHDNAFGLSGGQQQRLVIA
RAIAIEPEVLLLDEPTSALDPISTLTIEELITELKAKYTVVIVTHNMQQAARVSDQTAFM
YMGELVEYADTNTIFTTPSQRKTEDYITGRYG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory