Comparing 6937269 FitnessBrowser__SB2B:6937269 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2g6wA Suicide inhibition of a-oxamine synthase: structures of the covalent adducts of 8-amino-7-oxonanoate synthase with trifluoroalanine (see paper)
43% identity, 91% coverage: 15:363/385 of query aligns to 26:379/383 of 2g6wA
P12998 8-amino-7-oxononanoate synthase; AONS; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; EC 2.3.1.47 from Escherichia coli (strain K12) (see 2 papers)
43% identity, 91% coverage: 15:363/385 of query aligns to 27:380/384 of P12998
Sites not aligning to the query:
1djeA Crystal structure of the plp-bound form of 8-amino-7-oxonanoate synthase (see paper)
43% identity, 91% coverage: 15:363/385 of query aligns to 26:379/383 of 1djeA
1dj9A Crystal structure of 8-amino-7-oxonanoate synthase (or 7-keto- 8aminipelargonate or kapa synthase) complexed with plp and the product 8(s)-amino-7-oxonanonoate (or kapa). The enzyme of biotin biosynthetic pathway. (see paper)
43% identity, 91% coverage: 15:363/385 of query aligns to 26:379/383 of 1dj9A
Sites not aligning to the query:
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
30% identity, 87% coverage: 34:368/385 of query aligns to 48:390/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
30% identity, 87% coverage: 34:368/385 of query aligns to 48:390/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
30% identity, 87% coverage: 34:368/385 of query aligns to 48:390/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
30% identity, 87% coverage: 34:368/385 of query aligns to 48:390/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
30% identity, 87% coverage: 34:368/385 of query aligns to 48:390/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
30% identity, 87% coverage: 34:368/385 of query aligns to 48:390/394 of 8guhA
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
30% identity, 87% coverage: 34:368/385 of query aligns to 48:390/392 of 3a2bA
Q8GW43 8-amino-7-oxononanoate synthase; AONS; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; Biotin synthase 4; Biotin synthase F; AtbioF; EC 2.3.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 89% coverage: 24:364/385 of query aligns to 97:456/476 of Q8GW43
Sites not aligning to the query:
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
31% identity, 89% coverage: 31:371/385 of query aligns to 46:395/398 of 7poaA
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
30% identity, 96% coverage: 1:371/385 of query aligns to 1:394/396 of 3tqxA
Q0P5L8 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 from Bos taurus (Bovine) (see paper)
30% identity, 92% coverage: 18:371/385 of query aligns to 41:416/419 of Q0P5L8
Sites not aligning to the query:
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
32% identity, 89% coverage: 31:371/385 of query aligns to 44:395/398 of P0AB77
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
32% identity, 89% coverage: 31:371/385 of query aligns to 47:398/401 of 1fc4A
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
30% identity, 87% coverage: 31:366/385 of query aligns to 46:392/400 of 7v58B
6hrhA Structure of human erythroid-specific 5'-aminolevulinate synthase, alas2
31% identity, 88% coverage: 25:363/385 of query aligns to 43:394/429 of 6hrhA
5qreA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z117233350
31% identity, 88% coverage: 25:363/385 of query aligns to 43:394/429 of 5qreA
Sites not aligning to the query:
>6937269 FitnessBrowser__SB2B:6937269
MNRLLHRLAEARVKAESAGLWRQRQRHSPALMDFSANDYLGLARDERLAEALAEGARRYG
VGSGASPLVSGYSEAHAELEAALCAATGHEAALLFCSGFAANLALCHALFDSTDTLVADK
LIHASMIDGILGSGANLKRYPHCDLSGAARLIERFPGTALLTESIFSMDGDLAPLLPLSN
LCESHNSLFIVDDAHGFGVIGEQAMGASRLDGVNISLQLVTFGKALGCQGAAVLGSQALI
ESLVASARHYIYSTALSPAQAHAARVSLSLVQQGEKSATLAVNIRHFLNCAKEVGLALLP
SQSPIQLMPVPTVQACLMAADTLKARGFLVGAIRPPTVPAPRLRITLSAAQSMNSIEALV
NALADIEKGFGEGVNECVVKGSDKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory