Comparing 6937298 FitnessBrowser__SB2B:6937298 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
55% identity, 96% coverage: 1:220/230 of query aligns to 3:223/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
50% identity, 97% coverage: 1:222/230 of query aligns to 1:228/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
50% identity, 97% coverage: 1:222/230 of query aligns to 1:228/230 of 1l2tA
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
50% identity, 96% coverage: 1:221/230 of query aligns to 4:225/650 of 5ws4A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
46% identity, 97% coverage: 1:223/230 of query aligns to 3:226/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
46% identity, 97% coverage: 1:223/230 of query aligns to 3:226/592 of 5lj7A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
49% identity, 93% coverage: 1:215/230 of query aligns to 4:219/648 of P75831
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
47% identity, 87% coverage: 19:217/230 of query aligns to 17:216/223 of 2pclA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
46% identity, 91% coverage: 7:215/230 of query aligns to 11:221/233 of P75957
7mdyC Lolcde nucleotide-bound
45% identity, 93% coverage: 1:215/230 of query aligns to 2:218/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
45% identity, 93% coverage: 1:215/230 of query aligns to 2:218/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
45% identity, 91% coverage: 7:215/230 of query aligns to 10:220/229 of 7v8iD
8g4cB Bceabs atpgs high res tm (see paper)
38% identity, 86% coverage: 19:215/230 of query aligns to 21:219/248 of 8g4cB
Sites not aligning to the query:
7tchB Bceab e169q variant atp-bound conformation (see paper)
37% identity, 86% coverage: 19:215/230 of query aligns to 20:218/245 of 7tchB
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 96% coverage: 1:220/230 of query aligns to 1:223/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
41% identity, 96% coverage: 1:220/230 of query aligns to 2:224/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
41% identity, 96% coverage: 1:220/230 of query aligns to 2:224/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
41% identity, 96% coverage: 1:220/230 of query aligns to 2:224/344 of 3tuiC
3c4jA Abc protein artp in complex with atp-gamma-s
39% identity, 99% coverage: 1:227/230 of query aligns to 3:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
39% identity, 99% coverage: 1:227/230 of query aligns to 3:225/242 of 3c41J
>6937298 FitnessBrowser__SB2B:6937298
MISLQALTKSFRMGDAEVQALRGVDIHIRQNEFVAIMGPSGSGKSTLMNIIGCLDRPTSG
NYLLNGSAVGGLSDDALSAVRNREIGFVFQSFHLLPRLSALDNVLLPLRFSETPRGDRQH
AIELLERVGLGQRLDHRPNQLSGGQRQRVAIARALVNRPTLLLADEPTGALDSKTSVEIM
ALFDELHLSGQTIVLVTHEEEVAECAGRIIRMRDGVVQQDKQKPREVSNG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory