Comparing 6937316 FitnessBrowser__SB2B:6937316 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
43% identity, 89% coverage: 7:227/249 of query aligns to 4:225/226 of 5xu1B
7arlD Lolcde in complex with lipoprotein and adp (see paper)
48% identity, 85% coverage: 11:222/249 of query aligns to 7:220/222 of 7arlD
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
48% identity, 85% coverage: 11:222/249 of query aligns to 10:223/233 of P75957
7mdyC Lolcde nucleotide-bound
48% identity, 85% coverage: 11:222/249 of query aligns to 7:220/226 of 7mdyC
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
48% identity, 85% coverage: 11:222/249 of query aligns to 9:222/229 of 7v8iD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
47% identity, 86% coverage: 11:223/249 of query aligns to 8:217/223 of 2pclA
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
42% identity, 87% coverage: 7:222/249 of query aligns to 2:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
42% identity, 87% coverage: 7:222/249 of query aligns to 2:223/230 of 1l2tA
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
42% identity, 88% coverage: 3:222/249 of query aligns to 1:221/650 of 5ws4A
8g4cB Bceabs atpgs high res tm (see paper)
39% identity, 80% coverage: 25:222/249 of query aligns to 22:221/248 of 8g4cB
Sites not aligning to the query:
7tchB Bceab e169q variant atp-bound conformation (see paper)
39% identity, 80% coverage: 25:222/249 of query aligns to 21:220/245 of 7tchB
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
39% identity, 88% coverage: 12:230/249 of query aligns to 10:229/648 of P75831
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
38% identity, 92% coverage: 4:231/249 of query aligns to 1:229/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
38% identity, 92% coverage: 4:231/249 of query aligns to 1:229/615 of 5lilA
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
41% identity, 79% coverage: 26:222/249 of query aligns to 18:215/219 of 8w6iD
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
41% identity, 79% coverage: 26:222/249 of query aligns to 18:215/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
40% identity, 79% coverage: 26:222/249 of query aligns to 18:215/218 of 8hd0A
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
37% identity, 80% coverage: 9:208/249 of query aligns to 3:202/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
37% identity, 80% coverage: 9:208/249 of query aligns to 3:202/229 of 6z67B
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
42% identity, 84% coverage: 21:230/249 of query aligns to 13:222/241 of 4u00A
Sites not aligning to the query:
>6937316 FitnessBrowser__SB2B:6937316
MSKMHAIKVVHLKKKVQTQEGELTILKGVDMEVKPGESVAIIGPSGSGKSTLLGLLAALD
TPSEGEIWLDGSALSNLGEEAKAALRKKKISFIFQSFMLVDTLTALENVMLPAELAGMKD
AKAKAEAMLERVGLSHRVNHLPKQLSGGEQQRVAIARAFICEPKVLFADEPTGNLDGGNA
HKVADMLFALNAELGTTLVLVTHDNQLALRCQRQFTMTEGELAETTAAQEAPRQDAQAEV
ETNIKEAAC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory