Comparing 6937361 FitnessBrowser__SB2B:6937361 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
31% identity, 91% coverage: 14:290/304 of query aligns to 12:289/291 of 3na8A
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
31% identity, 88% coverage: 5:272/304 of query aligns to 3:273/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 88% coverage: 5:272/304 of query aligns to 2:272/294 of Q9X1K9
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
31% identity, 90% coverage: 5:277/304 of query aligns to 2:275/294 of Q8UGL3
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
30% identity, 94% coverage: 6:291/304 of query aligns to 3:288/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
30% identity, 94% coverage: 6:291/304 of query aligns to 3:288/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
30% identity, 94% coverage: 6:291/304 of query aligns to 3:288/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
30% identity, 94% coverage: 6:291/304 of query aligns to 3:288/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
30% identity, 94% coverage: 6:291/304 of query aligns to 3:288/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
30% identity, 94% coverage: 6:291/304 of query aligns to 3:288/291 of 3pueB
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
32% identity, 91% coverage: 5:280/304 of query aligns to 3:278/293 of 5t25A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
32% identity, 91% coverage: 5:280/304 of query aligns to 2:277/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
32% identity, 91% coverage: 5:280/304 of query aligns to 2:277/292 of P0A6L2
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
31% identity, 91% coverage: 5:280/304 of query aligns to 2:277/292 of 3i7sA
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
31% identity, 90% coverage: 5:277/304 of query aligns to 2:275/294 of 4i7wA
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
30% identity, 89% coverage: 5:276/304 of query aligns to 5:274/295 of Q5HG25
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
28% identity, 91% coverage: 5:281/304 of query aligns to 3:284/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
28% identity, 91% coverage: 5:281/304 of query aligns to 3:284/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 91% coverage: 5:281/304 of query aligns to 3:284/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 91% coverage: 5:281/304 of query aligns to 3:284/298 of 4oe7B
>6937361 FitnessBrowser__SB2B:6937361
MKVNWQGVYPAISTQFNEDGSINFASNTRMLEQLILDGINGIIALGTIGENASLSADEKR
AFLKHTVETVAGRIPVIAGCTENTAQLAIQYVQDVEAIGVDGVMLLPAVVYRGTDREVLT
HYQMVARATRLPIMIYNNPVSYGVDINLDMTAILANEPNIVAIKESTTDTRRLTELQSRF
GDRFTLFCGVDDIALESLLLGATGWISGLTNVFPRESVTLYKLARAGRMEEAREIYRWFM
PLLRLDTIPTLVQCIKFAEQLAGRGSEQVRMPRMTLIGDERAYVENVVGEAMANRIDLSK
YNLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory