SitesBLAST
Comparing 6937363 FitnessBrowser__SB2B:6937363 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
6j39A Crystal structure of cmis2 with inhibitor (see paper)
27% identity, 94% coverage: 26:427/428 of query aligns to 9:368/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (≠ L76), P46 (= P78), N49 (≠ P81), R243 (≠ A302), Y252 (≠ I309), Y267 (≠ V323), R308 (= R367), R334 (≠ H393), I335 (≠ L394)
- binding flavin-adenine dinucleotide: G9 (= G26), V10 (= V27), I11 (= I28), V29 (≠ I46), D30 (= D47), P31 (≠ K48), E32 (= E49), K36 (≠ G54), A37 (= A55), S38 (= S56), V40 (≠ G58), S41 (≠ N59), A42 (= A60), G43 (= G61), M44 (≠ L76), A174 (≠ S235), A203 (= A264), W206 (= W267), I228 (≠ H288), Y252 (≠ I309), R308 (= R367), S333 (≠ Q392), R334 (≠ H393), I335 (≠ L394), G336 (= G395), V337 (≠ L396), Q338 (≠ T397)
Sites not aligning to the query:
6j38A Crystal structure of cmis2 (see paper)
27% identity, 94% coverage: 26:427/428 of query aligns to 9:368/368 of 6j38A
- binding flavin-adenine dinucleotide: G9 (= G26), I11 (= I28), V29 (≠ I46), D30 (= D47), P31 (≠ K48), K36 (≠ G54), A37 (= A55), S38 (= S56), S41 (≠ N59), A42 (= A60), G43 (= G61), M44 (≠ L76), A174 (≠ S235), A203 (= A264), W206 (= W267), G226 (= G286), G306 (= G365), R308 (= R367), S333 (≠ Q392), R334 (≠ H393), I335 (≠ L394), G336 (= G395), V337 (≠ L396), Q338 (≠ T397)
Sites not aligning to the query:
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
28% identity, 54% coverage: 181:413/428 of query aligns to 116:347/363 of 7cyxA
- binding flavin-adenine dinucleotide: V171 (= V236), G200 (≠ A264), G201 (= G265), W203 (= W267), G298 (= G365), R300 (= R367), P301 (= P368), Y326 (≠ Q392), R327 (≠ H393), N328 (≠ L394), G329 (= G395), I330 (≠ L396)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 30, 31, 32, 38, 39, 40, 43, 45, 46
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 70% coverage: 126:426/428 of query aligns to 65:367/368 of 4yshB
- active site: I262 (vs. gap), L283 (= L340), G305 (= G365), N335 (≠ L394), L338 (≠ T397)
- binding flavin-adenine dinucleotide: V178 (= V236), S206 (≠ A264), W209 (= W267), R307 (= R367), H332 (= H391), R334 (≠ H393), N335 (≠ L394), G336 (= G395), I337 (≠ L396), L338 (≠ T397)
- binding glycine: G249 (≠ K307), Y251 (≠ I309), Y251 (≠ I309), A264 (≠ G321), R307 (= R367), R334 (≠ H393), R334 (≠ H393)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 70% coverage: 126:426/428 of query aligns to 65:367/370 of 4yshA
- active site: I262 (vs. gap), L283 (= L340), G305 (= G365), N335 (≠ L394), L338 (≠ T397)
- binding flavin-adenine dinucleotide: V178 (= V236), S206 (≠ A264), G207 (= G265), W209 (= W267), R307 (= R367), H332 (= H391), R334 (≠ H393), N335 (≠ L394), G336 (= G395), I337 (≠ L396)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
24% identity, 70% coverage: 126:426/428 of query aligns to 66:369/377 of Q5L2C2
- V180 (= V236) binding
- R309 (= R367) binding
- 334:340 (vs. 391:397, 29% identical) binding
- R336 (≠ H393) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
25% identity, 65% coverage: 135:412/428 of query aligns to 77:348/369 of S5FMM4
- K81 (≠ L139) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ A264) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ L396) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L406) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
24% identity, 95% coverage: 19:423/428 of query aligns to 2:364/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G24), G9 (= G26), I10 (≠ V27), D30 (= D47), N32 (≠ E49), H33 (vs. gap), K36 (≠ V51), A37 (= A52), T38 (≠ A53), A40 (= A55), G41 (≠ S56), A42 (≠ F57), G43 (= G58), V44 (≠ N59), Y174 (≠ S235), A203 (= A264), W206 (= W267), I210 (≠ L271), Y250 (≠ I309), G305 (= G365), R307 (= R367), G333 (≠ Q392), A334 (≠ H393), S335 (≠ L394), G336 (= G395), L337 (= L396), T338 (= T397)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
26% identity, 60% coverage: 173:427/428 of query aligns to 131:400/824 of Q8GAI3
Sites not aligning to the query:
- 66 mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- 67 H→A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
24% identity, 66% coverage: 136:418/428 of query aligns to 78:354/369 of O31616
- V174 (= V236) binding
- H244 (≠ K307) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R367) binding
- 327:333 (vs. 391:397, 29% identical) binding
- R329 (≠ H393) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
24% identity, 66% coverage: 136:418/428 of query aligns to 78:354/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ S235), V174 (= V236), S202 (≠ A264), G203 (= G265), W205 (= W267), F209 (≠ L271), G300 (= G365), R302 (= R367), H327 (= H391), F328 (≠ Q392), R329 (≠ H393), N330 (≠ L394), G331 (= G395), I332 (≠ L396)
- binding glycolic acid: Y246 (≠ I309), R302 (= R367), R329 (≠ H393)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
24% identity, 66% coverage: 136:418/428 of query aligns to 78:354/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ I309), R302 (= R367), R329 (≠ H393)
- binding flavin-adenine dinucleotide: V174 (= V236), S202 (≠ A264), G203 (= G265), W205 (= W267), F209 (≠ L271), G300 (= G365), R302 (= R367), H327 (= H391), R329 (≠ H393), N330 (≠ L394), G331 (= G395), I332 (≠ L396)
- binding phosphate ion: R89 (≠ L148), R254 (≠ T317)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
Query Sequence
>6937363 FitnessBrowser__SB2B:6937363
MKTNPMKINAGTPDSVNQQVIVIGAGVIGLANAVTLARRGFKVTVIDKEGVAAGASFGNA
GHFATEQVFPLADPSLLPKLPKMLLDPLGPFRIRPAYFHRALPWFVRFIVNMMPARRQHN
GNAIKALNARSMAATKELLTFCGRADLLVENGSLLVFETQDPRVMEQELALYNDAGIAVR
LLSGDEARALEPDLSDAISGALWFTEVGHTPNPRAICEALADTLKALGGRIEIDSVCSLQ
GGNTPSVTTETGKVTKADKLLLCAGAWSRPLALKLGHRVPLETERGYHLMMPQHSGLKRP
VASYERKFIITPMEDGTRLAGTVEFGGLNAPMSNARADCLLPHARVLLPKVFATARVSEG
KRWMGFRPSLPDSLPVLGESQTPGVYFAFGHQHLGLTWAASSAELLGQLICGETPSIDLS
PYCVKRFD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory