Comparing 6937461 FitnessBrowser__SB2B:6937461 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P37595 Isoaspartyl peptidase; Beta-aspartyl-peptidase; EcAIII; Isoaspartyl dipeptidase; EC 3.4.19.5 from Escherichia coli (strain K12) (see 2 papers)
53% identity, 96% coverage: 13:327/327 of query aligns to 6:314/321 of P37595
Q7L266 Isoaspartyl peptidase/L-asparaginase; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase; EC 3.4.19.5; EC 3.5.1.1 from Homo sapiens (Human) (see 4 papers)
39% identity, 93% coverage: 9:312/327 of query aligns to 2:287/308 of Q7L266
4osxA Structure of uncleaved glycine-bound human l-asparaginase protein (see paper)
39% identity, 93% coverage: 9:312/327 of query aligns to 3:279/300 of 4osxA
4pvrA Crystal structure of partially-cleaved human l-asparaginase protein in complex with l-aspartate (see paper)
38% identity, 93% coverage: 9:312/327 of query aligns to 3:277/298 of 4pvrA
4o0hA Crystal structure of human l-asparaginase protein with covalently linked substrate l-asparagine (see paper)
38% identity, 93% coverage: 9:312/327 of query aligns to 3:274/295 of 4o0hA
8c0iAAA Isoaspartyl peptidase subunit alpha (see paper)
54% identity, 46% coverage: 13:164/327 of query aligns to 5:156/156 of 8c0iAAA
1jn9A Structure of putative asparaginase encoded by escherichia coli ybik gene (see paper)
54% identity, 46% coverage: 13:164/327 of query aligns to 5:156/158 of 1jn9A
4o48A Crystal structure of cleaved guinea pig l-asparaginase type iii in complex with l-aspartate (see paper)
37% identity, 92% coverage: 13:312/327 of query aligns to 6:277/298 of 4o48A
2zalB Crystal structure of e. Coli isoaspartyl aminopeptidase/l-asparaginase in complex with l-aspartate (see paper)
59% identity, 41% coverage: 192:326/327 of query aligns to 1:135/135 of 2zalB
1p4vA Crystal structure of the glycosylasparaginase precursor d151n mutant with glycine (see paper)
39% identity, 72% coverage: 48:283/327 of query aligns to 23:241/295 of 1p4vA
Q47898 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Elizabethkingia miricola (Chryseobacterium miricola) (see 5 papers)
39% identity, 72% coverage: 48:283/327 of query aligns to 68:286/340 of Q47898
Sites not aligning to the query:
8c23DDD Isoaspartyl peptidase subunit beta (see paper)
58% identity, 41% coverage: 192:326/327 of query aligns to 1:135/135 of 8c23DDD
4r4yA Structural basis of a point mutation that causes the genetic disease aspartylglucosaminuria (see paper)
39% identity, 72% coverage: 48:283/327 of query aligns to 21:239/293 of 4r4yA
Q9H6P5 Threonine aspartase 1; Taspase-1; EC 3.4.25.- from Homo sapiens (Human) (see 2 papers)
31% identity, 95% coverage: 13:324/327 of query aligns to 44:370/420 of Q9H6P5
2gezB Crystal structure of potassium-independent plant asparaginase (see paper)
52% identity, 41% coverage: 192:324/327 of query aligns to 1:130/133 of 2gezB
4pu6B Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ cations (see paper)
49% identity, 41% coverage: 192:324/327 of query aligns to 1:130/131 of 4pu6B
2a8jB Crystal structure of human taspase1 (acivated form) (see paper)
30% identity, 86% coverage: 13:293/327 of query aligns to 4:253/313 of 2a8jB
2gezC Crystal structure of potassium-independent plant asparaginase (see paper)
40% identity, 46% coverage: 11:160/327 of query aligns to 3:151/166 of 2gezC
4pv2C Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ and na+ cations (see paper)
40% identity, 47% coverage: 11:164/327 of query aligns to 3:154/158 of 4pv2C
P20933 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Homo sapiens (Human) (see 11 papers)
32% identity, 65% coverage: 39:252/327 of query aligns to 36:266/346 of P20933
Sites not aligning to the query:
>6937461 FitnessBrowser__SB2B:6937461
MTPASAQENPFGIAIHGGAGTISKARLTDEQEQAYRDKLEEAVNAGHKILAKGGDSLDAV
KAAINILEDSPLFNAGMGAVYTFDGTHELDASIMDGNTMNAGAVAGVKHIKNPIDLALVV
MNKSDHVMLSGVGAEEFALTQGMPLVPANTFDTDSRYQQLLDAKAKINAAESAAKDFHAS
ATSLDLDYKFGTVGAVALDKNGNLAAGTSTGGMTAKRFGRIGDSPVIGAGTYAENGVCAV
SATGHGEYFIRYHVAADICARMKYQQKNVIQASDEVINQRLVEAGGSGGIIAIDAQGNVA
TPFNTEGMYRASRVNKDAPLIMIWRDK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory