SitesBLAST
Comparing 6937470 FitnessBrowser__SB2B:6937470 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u0mA Fatty aldehyde dehydrogenase from marinobacter aquaeolei vt8 and cofactor complex (see paper)
61% identity, 98% coverage: 13:495/495 of query aligns to 7:488/488 of 5u0mA
- active site: N148 (= N154), K171 (= K177), E246 (= E252), C280 (= C286), E377 (= E384), P455 (≠ A462)
- binding nicotinamide-adenine-dinucleotide: F144 (= F150), Y147 (= Y153), N148 (= N154), K171 (= K177), S173 (= S179), E174 (= E180), G207 (= G213), T222 (= T228), G223 (= G229), S224 (= S230), V227 (≠ T233), E246 (= E252), M247 (= M253), G248 (= G254), C280 (= C286), E377 (= E384), F379 (= F386)
5u0lA X-ray crystal structure of fatty aldehyde dehydrogenase enzymes from marinobacter aquaeolei vt8 complexed with a substrate (see paper)
61% identity, 98% coverage: 13:495/495 of query aligns to 7:488/488 of 5u0lA
- active site: N148 (= N154), K171 (= K177), E246 (= E252), C280 (= C286), E377 (= E384), P455 (≠ A462)
- binding decanal: K107 (= K113), H152 (= H158), L153 (= L159), G156 (= G162), H157 (= H163), S456 (= S463), A457 (= A464)
3ju8A Crystal structure of succinylglutamic semialdehyde dehydrogenase from pseudomonas aeruginosa.
61% identity, 98% coverage: 10:493/495 of query aligns to 3:486/486 of 3ju8A
- active site: N147 (= N154), K170 (= K177), E245 (= E252), C279 (= C286), E377 (= E384), P455 (≠ A462)
- binding nicotinamide-adenine-dinucleotide: G144 (= G151), Y146 (= Y153), N147 (= N154), L152 (= L159), K170 (= K177), S172 (= S179), F220 (= F227), T221 (= T228), G222 (= G229), S223 (= S230), T226 (= T233), E245 (= E252), M246 (= M253), G247 (= G254), C279 (= C286), E377 (= E384), F379 (= F386), F444 (= F451)
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
33% identity, 91% coverage: 13:461/495 of query aligns to 9:462/489 of 4cazA
- active site: N152 (= N154), K175 (= K177), E251 (= E252), C285 (= C286), E386 (= E384)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (≠ F150), G149 (= G151), W151 (≠ Y153), N152 (= N154), K175 (= K177), E178 (= E180), G208 (vs. gap), G212 (= G213), F226 (= F227), T227 (= T228), G228 (= G229), G229 (≠ S230), T232 (= T233), V236 (≠ L237), E251 (= E252), L252 (≠ M253), C285 (= C286), E386 (= E384), F388 (= F386)
Sites not aligning to the query:
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
33% identity, 91% coverage: 13:461/495 of query aligns to 9:462/489 of 2woxA
- active site: N152 (= N154), K175 (= K177), E251 (= E252), C285 (= C286), E386 (= E384)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (≠ F150), G149 (= G151), W151 (≠ Y153), N152 (= N154), K175 (= K177), S177 (= S179), E178 (= E180), G208 (vs. gap), G212 (= G213), F226 (= F227), T227 (= T228), G228 (= G229), G229 (≠ S230), T232 (= T233), V236 (≠ L237), E251 (= E252), L252 (≠ M253), C285 (= C286), E386 (= E384), F388 (= F386)
Sites not aligning to the query:
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
33% identity, 91% coverage: 13:461/495 of query aligns to 9:462/489 of 2wmeA
- active site: N152 (= N154), K175 (= K177), E251 (= E252), C285 (= C286), E386 (= E384)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (= G151), W151 (≠ Y153), K175 (= K177), S177 (= S179), E178 (= E180), G208 (vs. gap), G212 (= G213), F226 (= F227), G228 (= G229), G229 (≠ S230), T232 (= T233), V236 (≠ L237)
Sites not aligning to the query:
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
33% identity, 91% coverage: 13:461/495 of query aligns to 10:463/490 of Q9HTJ1
- GAWN 150:153 (≠ GPYN 151:154) binding
- K162 (≠ H163) active site, Charge relay system
- KPSE 176:179 (= KPSE 177:180) binding
- G209 (vs. gap) binding
- GTST 230:233 (≠ SSNT 230:233) binding
- E252 (= E252) active site, Proton acceptor
- C286 (= C286) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E384) binding
Sites not aligning to the query:
- 464 active site, Charge relay system
Q56YU0 Aldehyde dehydrogenase family 2 member C4; ALDH1a; Protein REDUCED EPIDERMAL FLUORESCENCE 1; EC 1.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 97% coverage: 13:491/495 of query aligns to 23:499/501 of Q56YU0
- G152 (≠ A137) mutation to E: In ref1-7; reduced activity on sinapaldehyde.
- G416 (≠ A401) mutation to R: In ref1-6; reduced activity on sinapaldehyde.
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
33% identity, 93% coverage: 13:470/495 of query aligns to 14:472/482 of P25526
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
33% identity, 93% coverage: 13:470/495 of query aligns to 13:471/481 of 3jz4A
- active site: N156 (= N154), K179 (= K177), E254 (= E252), C288 (= C286), E385 (= E384), E462 (≠ A462)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P154 (= P152), W155 (≠ Y153), K179 (= K177), A181 (≠ S179), S182 (≠ E180), A212 (≠ V210), G216 (= G213), G232 (= G229), S233 (= S230), I236 (≠ T233), C288 (= C286), K338 (≠ A338), E385 (= E384), F387 (= F386)
4o6rA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
33% identity, 93% coverage: 13:471/495 of query aligns to 7:470/489 of 4o6rA
- active site: N150 (= N154), K173 (= K177), E248 (= E252), C282 (= C286), E383 (= E384), E460 (≠ A462)
- binding adenosine monophosphate: I146 (≠ F150), V147 (≠ G151), K173 (= K177), G206 (≠ V210), G210 (= G213), Q211 (≠ K214), F224 (= F227), G226 (= G229), S227 (= S230), T230 (= T233), R233 (≠ L236)
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
33% identity, 89% coverage: 23:461/495 of query aligns to 20:461/489 of 6wsbA
- active site: N152 (= N154), E250 (= E252), C284 (= C286)
- binding nicotinamide-adenine-dinucleotide: I148 (≠ F150), G149 (= G151), A150 (≠ P152), W151 (≠ Y153), N152 (= N154), K175 (= K177), E178 (= E180), G208 (≠ V210), G211 (= G213), A212 (≠ K214), F225 (= F227), T226 (= T228), G227 (= G229), G228 (≠ S230), T231 (= T233), V235 (≠ L237), E250 (= E252), L251 (≠ M253), G252 (= G254), C284 (= C286), E385 (= E384), F387 (= F386)
Sites not aligning to the query:
Q9H2A2 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 from Homo sapiens (Human) (see paper)
31% identity, 93% coverage: 13:470/495 of query aligns to 13:476/487 of Q9H2A2
- R109 (≠ V107) mutation to A: About 65-fold loss of catalytic efficiency.
- N155 (= N154) mutation to A: Complete loss of activity.
- R451 (≠ A445) mutation to A: Complete loss of activity.
5gtlA NADPH complex structure of aldehyde dehydrogenase from bacillus cereus
30% identity, 94% coverage: 7:469/495 of query aligns to 14:478/491 of 5gtlA
- active site: N165 (= N154), K188 (= K177), E263 (= E252), C297 (= C286), E394 (= E384), E471 (≠ A462)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I161 (≠ F150), P163 (= P152), K188 (= K177), A190 (≠ S179), E191 (= E180), Q192 (≠ L181), G221 (≠ E209), G225 (= G213), G241 (= G229), S242 (= S230), T245 (= T233), L264 (≠ M253), C297 (= C286), E394 (= E384), F396 (= F386)
5gtkA NAD+ complex structure of aldehyde dehydrogenase from bacillus cereus
30% identity, 94% coverage: 7:469/495 of query aligns to 14:478/491 of 5gtkA
- active site: N165 (= N154), K188 (= K177), E263 (= E252), C297 (= C286), E394 (= E384), E471 (≠ A462)
- binding nicotinamide-adenine-dinucleotide: I161 (≠ F150), I162 (≠ G151), P163 (= P152), W164 (≠ Y153), K188 (= K177), E191 (= E180), G221 (≠ E209), G225 (= G213), A226 (≠ K214), F239 (= F227), G241 (= G229), S242 (= S230), T245 (= T233), Y248 (≠ L236), L264 (≠ M253), C297 (= C286), Q344 (≠ A335), R347 (≠ A338), E394 (= E384), F396 (= F386)
8skfA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (lattice translocation disorder)
33% identity, 89% coverage: 23:461/495 of query aligns to 28:470/497 of 8skfA
- binding calcium ion: T33 (≠ S28), I34 (= I29), D100 (≠ E95), V187 (≠ L181)
- binding nicotinamide-adenine-dinucleotide: I156 (≠ F150), G157 (= G151), A158 (≠ P152), W159 (≠ Y153), K183 (= K177), E186 (= E180), G216 (≠ E209), G220 (= G213), T235 (= T228), G236 (= G229), G237 (≠ S230), S240 (≠ T233), K243 (≠ L236), E259 (= E252), C293 (= C286), F396 (= F386)
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
33% identity, 89% coverage: 23:461/495 of query aligns to 19:461/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
33% identity, 89% coverage: 23:461/495 of query aligns to 19:461/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
33% identity, 89% coverage: 23:461/495 of query aligns to 19:461/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
33% identity, 89% coverage: 23:461/495 of query aligns to 19:461/488 of 8vqwC
- binding coenzyme a: I147 (≠ F150), W150 (≠ Y153), K174 (= K177), S176 (= S179), E177 (= E180), G207 (≠ E209), G211 (= G213), F225 (= F227), G227 (= G229), G228 (≠ S230), S231 (≠ T233), H331 (≠ A335), F387 (= F386)
Query Sequence
>6937470 FitnessBrowser__SB2B:6937470
MSSVINNPSSCQFIGGQWQPGHGKGFESINPANGEVIWCGNGANAEQVDTAVKAARSAFY
NWSAMPLAERLAIIEAFGAQLGEHSEAMARLIAEETGKALWESRTEVAAMTGKIAISIRA
HSERTGTVENPMPGARAFIRHKPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTVLFKPSE
LTPKVAQFTVELWQKAGLPAGVINLLQGEVETGKALAGHPGIDGLFFTGSSNTGHLLHQQ
YAGQPGKILALEMGGNNPLIVKDVANVNAAVHDIIQSAFISSGQRCTCARRLFIKKDANG
DAILAKLIEASRQIRVDEPFAENQPFYGAMISAKAAAAMVKAQTDIQSLGGISLLELKQP
DLALGFVTPGIIDVTHVKALPDEEHFGPLLKVYRYDDFDAAIDEANNTAFGLSAGLLADN
EADYDHFFRRIRAGIVNWNKPITGASSAAPFGGIGASGNHRASAFYAADYCAYPVSSVEA
SSVSLPASLSPGLSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory