Comparing 6937491 FitnessBrowser__SB2B:6937491 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
68% identity, 98% coverage: 7:382/382 of query aligns to 2:377/377 of 7t1qA
7lgpB Dape enzyme from shigella flexneri
65% identity, 100% coverage: 1:381/382 of query aligns to 3:377/377 of 7lgpB
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
61% identity, 98% coverage: 6:380/382 of query aligns to 1:375/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
61% identity, 98% coverage: 6:380/382 of query aligns to 1:375/375 of 4pqaA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
60% identity, 99% coverage: 2:380/382 of query aligns to 1:379/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
61% identity, 97% coverage: 10:380/382 of query aligns to 5:375/377 of P44514
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
76% identity, 47% coverage: 6:185/382 of query aligns to 1:180/265 of 4op4B
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
64% identity, 46% coverage: 10:185/382 of query aligns to 7:182/258 of 4h2kA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium (see paper)
26% identity, 97% coverage: 11:381/382 of query aligns to 11:383/383 of 7uoiA
8uw6B Acetylornithine deacetylase from escherichia coli, di-zinc form.
27% identity, 66% coverage: 11:263/382 of query aligns to 7:262/381 of 8uw6B
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
28% identity, 49% coverage: 63:250/382 of query aligns to 95:281/426 of 3pfoA
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
24% identity, 81% coverage: 71:379/382 of query aligns to 79:398/408 of Q03154
3dljA Crystal structure of human carnosine dipeptidase 1
36% identity, 26% coverage: 62:161/382 of query aligns to 92:186/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
36% identity, 26% coverage: 62:161/382 of query aligns to 123:217/507 of Q96KN2
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
25% identity, 74% coverage: 72:352/382 of query aligns to 80:367/407 of P37111
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
25% identity, 48% coverage: 11:194/382 of query aligns to 24:212/458 of 2pokA
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
26% identity, 41% coverage: 49:203/382 of query aligns to 100:262/503 of Q8C165
Sites not aligning to the query:
4mmoA The crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus
23% identity, 38% coverage: 16:161/382 of query aligns to 10:155/437 of 4mmoA
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
33% identity, 19% coverage: 68:140/382 of query aligns to 95:167/475 of Q96KP4
Sites not aligning to the query:
3ki9A Crystal structure of staphylococcus aureus metallopeptidase (sapep/dape) in the mn2+ bound form (see paper)
39% identity, 18% coverage: 72:140/382 of query aligns to 85:151/467 of 3ki9A
Sites not aligning to the query:
>6937491 FitnessBrowser__SB2B:6937491
MSSPETHSDVIELTRELISRPSVTPLDEGCQDLMAKRLAAIGFTIEPMVFEDTTNLWARR
GTEGPVFCFAGHTDVVPVGDLNRWHTPPFDPVVIDGYIHGRGAADMKGSLAAMVVAAERF
VAEHPDHQGSIAFLITSDEEGPFINGTVRVVETLEARHEKITWALVGEPSSTHLLGDVVK
NGRRGSLTGNLTVKGIQGHVAYPHLADNPIHRAAPALAELSRIEWDKGNEFFPPTSFQIA
NINGGTGASNVIPGELKVMFNFRYSTEVTAETLIARVLGILDAHGLDYDIDWVFNGLPFL
TGEGPLLDATREAIFEVTGTHTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIHKVNECV
KASDLELLTGCYQRILEKLLCN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory