SitesBLAST
Comparing 6937531 FitnessBrowser__SB2B:6937531 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P05041 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Escherichia coli (strain K12) (see 4 papers)
57% identity, 97% coverage: 15:470/471 of query aligns to 7:453/453 of P05041
- S36 (= S43) binding
- E258 (= E275) mutation to A: The reaction is extremely slow.; mutation to D: The reaction is extremely slow.
- K274 (= K291) mutation to A: Absence of covalent intermediate. Addition of ammonia allows the formation of the covalent intermediate and shows that ammonia can replace the function of K-274. Reduced catalytic efficiency.; mutation to R: Absence of covalent intermediate.; mutation to R: Reduced catalytic efficiency.
- G275 (= G292) mutation to S: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
- R311 (= R328) mutation to K: Catalytically active in the NH3-dependent, but inactive for the glutamine-dependent reactions and fails to complex with PabA.
- R316 (= R333) mutation to H: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
- S322 (= S339) mutation to T: Complete loss of aminodeoxychorismate synthase activity.
- H339 (= H356) mutation to W: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
1k0eA The crystal structure of aminodeoxychorismate synthase from formate grown crystals (see paper)
55% identity, 97% coverage: 15:470/471 of query aligns to 5:437/437 of 1k0eA
- active site: E256 (= E275), K272 (= K291), E286 (= E319), H323 (= H356), S350 (= S383), W374 (≠ Y407), R394 (= R427), G410 (= G443), E423 (= E456), K427 (= K460)
- binding tryptophan: L32 (= L41), H33 (≠ D42), S34 (= S43), Y41 (≠ D50), F44 (≠ W53), P238 (= P257), F239 (= F258), S240 (= S259)
1k0gA The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
52% identity, 97% coverage: 15:470/471 of query aligns to 7:420/420 of 1k0gA
- active site: E258 (= E275), K274 (= K291), E278 (= E319), S333 (= S383), W357 (≠ Y407), R377 (= R427), G393 (= G443), E406 (= E456), K410 (= K460)
- binding phosphate ion: D113 (= D121), R116 (= R124), D347 (≠ E397), R353 (= R403)
- binding tryptophan: L34 (= L41), H35 (≠ D42), S36 (= S43), Y43 (≠ D50), S44 (≠ A51), F46 (≠ W53), P240 (= P257), F241 (= F258), S242 (= S259)
1k0gB The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
52% identity, 96% coverage: 15:468/471 of query aligns to 7:415/415 of 1k0gB
- active site: E258 (= E275), K274 (= K291), E277 (= E319), S330 (= S383), W354 (≠ Y407), R374 (= R427), G390 (= G443), E403 (= E456), K407 (= K460)
- binding phosphate ion: Y112 (= Y120), D113 (= D121), R116 (= R124), D344 (≠ E397), R350 (= R403)
- binding tryptophan: L34 (= L41), H35 (≠ D42), S36 (= S43), Y43 (≠ D50), S44 (≠ A51), R45 (≠ H52), F46 (≠ W53), P240 (= P257), F241 (= F258)
7pi1DDD Aminodeoxychorismate synthase component 1
35% identity, 94% coverage: 29:471/471 of query aligns to 20:459/459 of 7pi1DDD
- binding magnesium ion: G428 (= G443), E438 (= E453)
- binding tryptophan: L33 (= L41), E34 (≠ D42), S35 (= S43), G39 (≠ A51), Y41 (≠ W53), P242 (= P257), Y243 (≠ F258), M244 (≠ S259), Q406 (≠ D421), N408 (≠ S423)
P28820 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Bacillus subtilis (strain 168) (see paper)
35% identity, 94% coverage: 29:471/471 of query aligns to 22:466/470 of P28820
- A283 (≠ K291) mutation to I: Complete loss of aminodeoxychorismate synthase activity.; mutation to K: Absence of covalent intermediate.; mutation to V: Complete loss of aminodeoxychorismate synthase activity.
5cwaA Structure of anthranilate synthase component i (trpe) from mycobacterium tuberculosis with inhibitor bound (see paper)
34% identity, 92% coverage: 33:465/471 of query aligns to 44:491/505 of 5cwaA
- active site: Q248 (= Q228), E301 (= E275), A317 (≠ K291), E345 (= E319), H382 (= H356), T409 (≠ S383), Y433 (= Y407), R453 (= R427), G469 (= G443), E482 (= E456), K486 (= K460)
- binding 3-{[(1Z)-1-carboxyprop-1-en-1-yl]oxy}-2-hydroxybenzoic acid: Y433 (= Y407), I452 (= I426), A466 (= A440), G467 (= G441), K486 (= K460)
A0QX93 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 92% coverage: 33:465/471 of query aligns to 64:512/524 of A0QX93
- K355 (≠ I308) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7bvdA Anthranilate synthase component i (trpe)[mycolicibacterium smegmatis]
36% identity, 76% coverage: 109:465/471 of query aligns to 118:487/499 of 7bvdA
- active site: Q248 (= Q228), E301 (= E275), A317 (≠ K291), E341 (= E319), H378 (= H356), T405 (≠ S383), Y429 (= Y407), R449 (= R427), G465 (= G443), E478 (= E456), K482 (= K460)
Sites not aligning to the query:
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
37% identity, 70% coverage: 140:469/471 of query aligns to 332:671/673 of 8hx8A
Sites not aligning to the query:
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
42% identity, 56% coverage: 207:469/471 of query aligns to 369:632/632 of 8hx9A
- binding (3R,4R)-3-[(1-carboxyethenyl)oxy]-4-hydroxycyclohexa-1,5-diene-1-carboxylic acid: I453 (= I290), K454 (= K291), G455 (= G292), T456 (= T293), M547 (≠ I384), Y570 (= Y407), R590 (= R427), V603 (≠ A440), G604 (= G441), G605 (= G442), A606 (≠ G443), E619 (= E456), K623 (= K460)
- binding tryptophan: P419 (= P257), Y420 (≠ F258), G421 (≠ S259), L574 (≠ I411), G575 (= G412)
Sites not aligning to the query:
Q94GF1 Anthranilate synthase alpha subunit 1, chloroplastic; OsASA1; EC 4.1.3.27 from Oryza sativa subsp. japonica (Rice) (see paper)
31% identity, 75% coverage: 110:460/471 of query aligns to 171:559/577 of Q94GF1
- D323 (≠ S242) mutation to N: Insensitive to feedback inhibition by tryptophan.
O94582 Probable anthranilate synthase component 1; Anthranilate synthase component I; EC 4.1.3.27 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 86% coverage: 68:471/471 of query aligns to 59:478/489 of O94582
- S390 (≠ T385) modified: Phosphoserine
- S392 (≠ A387) modified: Phosphoserine
Sites not aligning to the query:
- 488 modified: Phosphoserine
P32068 Anthranilate synthase alpha subunit 1, chloroplastic; Anthranilate synthase component 1-1; Anthranilate synthase component I-1; Protein A-METHYL TRYPTOPHAN RESISTANT 1; Protein JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; Protein TRYPTOPHAN BIOSYNTHESIS 5; Protein WEAK ETHYLENE INSENSITIVE 2; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 75% coverage: 110:460/471 of query aligns to 189:577/595 of P32068
- D341 (≠ S242) mutation to N: In trp5-1; insensitive to feedback inhibition by tryptophan and resistance to the herbicide 6-methylanthranilate.
1i1qA Structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium (see paper)
32% identity, 74% coverage: 116:465/471 of query aligns to 144:503/512 of 1i1qA
- active site: Q259 (= Q228), E305 (= E275), A323 (≠ K291), E357 (= E319), H394 (= H356), T421 (≠ S383), Y445 (= Y407), R465 (= R427), G481 (= G443), E494 (= E456), K498 (= K460)
- binding tryptophan: P287 (= P257), Y288 (≠ F258), M289 (≠ S259), G450 (= G412), C461 (≠ S423)
Sites not aligning to the query:
P00898 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
32% identity, 74% coverage: 116:465/471 of query aligns to 148:507/520 of P00898
- C174 (= C143) mutation to Y: Almost no change in feedback control by tryptophan.
- N288 (= N254) mutation to D: Decrease in feedback control by tryptophan.
- P289 (≠ V255) mutation to L: Decrease in feedback control by tryptophan.
- M293 (≠ S259) mutation to T: Complete loss of feedback control by tryptophan.
- F294 (≠ A260) mutation to L: Decrease in feedback control by tryptophan.
- G305 (≠ S271) mutation to S: Decrease in feedback control by tryptophan.
- R402 (≠ T360) mutation to W: Almost no change in feedback control by tryptophan.
- G460 (= G418) mutation to D: Almost no change in feedback control by tryptophan.
- C465 (≠ S423) mutation to Y: Complete loss of feedback control by tryptophan. 4-fold decrease of affinity binding for chorismate.
Sites not aligning to the query:
- 39 E→K: Complete loss of feedback control by tryptophan.
- 40 binding ; S→F: Complete loss of feedback control by tryptophan.
- 41 A→V: Decrease in feedback control by tryptophan.
- 50 binding
- 128 R→H: Almost no change in feedback control by tryptophan.
- 515 H→Y: Almost no change in feedback control by tryptophan.
P00897 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Serratia marcescens (see paper)
31% identity, 74% coverage: 116:465/471 of query aligns to 147:506/519 of P00897
Sites not aligning to the query:
1i7sA Anthranilate synthase from serratia marcescens in complex with its end product inhibitor l-tryptophan (see paper)
31% identity, 74% coverage: 116:465/471 of query aligns to 139:498/511 of 1i7sA
- active site: Q254 (= Q228), E300 (= E275), A318 (≠ K291), E352 (= E319), H389 (= H356), T416 (≠ S383), Y440 (= Y407), R460 (= R427), G476 (= G443), E489 (= E456), K493 (= K460)
- binding tryptophan: P282 (= P257), Y283 (≠ F258), M284 (≠ S259), V444 (≠ I411), G445 (= G412), D454 (= D421), C456 (≠ S423)
Sites not aligning to the query:
1i7qA Anthranilate synthase from s. Marcescens (see paper)
31% identity, 74% coverage: 116:465/471 of query aligns to 145:504/517 of 1i7qA
- active site: Q260 (= Q228), E306 (= E275), A324 (≠ K291), E358 (= E319), H395 (= H356), T422 (≠ S383), Y446 (= Y407), R466 (= R427), G482 (= G443), E495 (= E456), K499 (= K460)
- binding magnesium ion: E358 (= E319), E495 (= E456)
- binding pyruvic acid: Y446 (= Y407), I465 (= I426), R466 (= R427), A479 (= A440), G480 (= G441), K499 (= K460)
5jy9B An iron-bound structure of the salicylate synthase irp9 (see paper)
33% identity, 46% coverage: 251:468/471 of query aligns to 206:422/424 of 5jy9B
- active site: E230 (= E275), A246 (≠ K291), E274 (= E319), H311 (= H356), T338 (≠ S383), Y362 (= Y407), R381 (= R427), G397 (= G443), E410 (= E456), K414 (= K460)
- binding fe (ii) ion: E274 (= E319), E410 (= E456)
Sites not aligning to the query:
Query Sequence
>6937531 FitnessBrowser__SB2B:6937531
MFPPLPTRINHAQLAVKTLDWTASTSDIFTPLASQPWSMLLDSADAPHMDAHWDILVAAP
VATLKVYESHSELTYAGNTLRLDTSECPFSQLQSVQHALFSVQKNTSLPFAGGALGSFNY
DLGRRIERLPSTALDDINLPLACIGFYDWALMRSYQSDSWQLVHYLGDDALNETLAWLEQ
QRDFAQAGAESNTSFSLLTEFTPQITRDQYQQKFNQVQSYLASGDCYQINLTQRFSADYQ
GSEWQAYLKLRSANVAPFSAFVRLEEGAILSISPERFIKLDGRQVETKPIKGTLPRLPDP
DADKTNAILLKASPKDRAENLMIVDLLRNDIGRVASPGSVRVPKLFEVESFPAVHHLVST
VTAQLAENKDAFDLLRAAFPGGSITGAPKIRAMEIIEELEPSRRSIYCGSIGYISQHGNM
DTSITIRTLAAVDGKLYCWAGGGVVADSIADSEYQETFDKISRILPILEQE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory