Comparing 6937552 FitnessBrowser__SB2B:6937552 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1yw4A Crystal structure of the succinylglutamate desuccinylase from chromobacterium violaceum, northeast structural genomics target cvr22.
40% identity, 96% coverage: 11:345/348 of query aligns to 6:318/319 of 1yw4A
2bcoA X-ray structure of succinylglutamate desuccinalase from vibrio parahaemolyticus (rimd 2210633) at the resolution 2.3 a, northeast structural genomics target vpr14
36% identity, 92% coverage: 21:339/348 of query aligns to 15:323/338 of 2bcoA
>6937552 FitnessBrowser__SB2B:6937552
MLNLLQGCKDFLHLTLSNPEHLDPIAPQPLYGHTLVSLWDTGVLVFEPVDGNSHKDIVLS
SGVHGNETAPIELCNGLIQDVLEGRLQVKERVLFLIGNPAAINNGTRIVDENMNRLFSGE
HSRGPGLSNPERVRAKKLETYVTRFFEKGAEKGEGRQRIHYDLHTAIRGSKHEKFAIYPY
RPGRAFSGEQIMFLAASGVDTVLFHHEPTTTFSYFSSELFRADAFTIELGKVYPMGQNDM
SKFANTREMFKRLICAEPLELAPFDETQVNLYQVCRVINKEVDDFEFTFSTDVENFSAFP
RGHVIARQGGKDILVEQEAEAVVFPNAKVPVGQRTVIMLVPAVNPHVE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory