Comparing 6937554 FitnessBrowser__SB2B:6937554 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
62% identity, 99% coverage: 3:325/325 of query aligns to 4:326/326 of 1dtwB
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
62% identity, 99% coverage: 3:325/325 of query aligns to 7:329/329 of 2j9fD
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
62% identity, 99% coverage: 3:325/325 of query aligns to 70:392/392 of P21953
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
53% identity, 100% coverage: 1:325/325 of query aligns to 1:324/324 of Q5SLR3
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
53% identity, 100% coverage: 2:325/325 of query aligns to 1:323/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
53% identity, 100% coverage: 2:325/325 of query aligns to 1:323/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
53% identity, 100% coverage: 2:325/325 of query aligns to 1:323/323 of 1umbD
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
48% identity, 98% coverage: 4:320/325 of query aligns to 5:333/338 of 1qs0B
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
47% identity, 100% coverage: 2:325/325 of query aligns to 1:324/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
47% identity, 100% coverage: 2:325/325 of query aligns to 1:324/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
47% identity, 100% coverage: 2:325/325 of query aligns to 1:324/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
47% identity, 100% coverage: 2:325/325 of query aligns to 1:324/324 of 1w85B
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
34% identity, 99% coverage: 3:325/325 of query aligns to 32:359/359 of P11177
Sites not aligning to the query:
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
34% identity, 99% coverage: 3:325/325 of query aligns to 3:330/330 of 6cfoB
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
34% identity, 99% coverage: 3:325/325 of query aligns to 4:331/331 of 6cerD
6yakDDD C-terminal component of the split chain transketolase (see paper)
27% identity, 81% coverage: 19:281/325 of query aligns to 18:265/311 of 6yakDDD
2o1xA 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from deinococcus radiodurans (see paper)
22% identity, 75% coverage: 52:296/325 of query aligns to 316:541/578 of 2o1xA
Sites not aligning to the query:
6xxgAAA 1-deoxy-D-xylulose-5-phosphate synthase,1-deoxy-D-xylulose-5-phosphate synthase (see paper)
22% identity, 75% coverage: 52:296/325 of query aligns to 299:524/560 of 6xxgAAA
Sites not aligning to the query:
6xxgBBB 1-deoxy-D-xylulose-5-phosphate synthase,1-deoxy-D-xylulose-5-phosphate synthase (see paper)
22% identity, 75% coverage: 52:296/325 of query aligns to 277:502/539 of 6xxgBBB
Sites not aligning to the query:
Q9RUB5 1-deoxy-D-xylulose-5-phosphate synthase; 1-deoxyxylulose-5-phosphate synthase; DXP synthase; DXPS; EC 2.2.1.7 from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) (see paper)
22% identity, 75% coverage: 52:296/325 of query aligns to 365:590/629 of Q9RUB5
Sites not aligning to the query:
>6937554 FitnessBrowser__SB2B:6937554
MAEMNMLQAINSALRIAMEKDPTMLVFGEDVGHFGGVFRATSGLQDTFGRGRCFNTPLTE
QGIAGFANGLASNGTTAVAEIQFADYIFPAFDQIVNESAKFRYRSGNEFNVGGLVYRTPY
GGGIAGGHYHSQSPEAYFTQTPGLKVVVPRNAHQAKGLLLASIRDKNPVVFFEPKRLYRA
SVGEVPEGDYELPLGKAEVVKEGKDITLLAWGAQMEIVEKAAEMAEKEGISCEIIDLRTL
SPWDVDTVAESVKKTGRLLINHEAPLTGGFAGEIAATIQEECFLYLESPIARVCGLDTPY
PLIHEKEYMPDALKTFEAIKASVNF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory