Comparing 6937743 FitnessBrowser__SB2B:6937743 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rz0A Crystal structure of escherichia coli glyoxalase ii
45% identity, 100% coverage: 2:258/258 of query aligns to 1:251/251 of 6rz0A
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
41% identity, 100% coverage: 2:258/258 of query aligns to 71:324/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
41% identity, 100% coverage: 2:258/258 of query aligns to 1:254/254 of 2q42A
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
45% identity, 100% coverage: 1:258/258 of query aligns to 2:259/259 of 8ewoA
2qedA Crystal structure of salmonella thyphimurium lt2 glyoxalase ii (see paper)
42% identity, 100% coverage: 2:258/258 of query aligns to 2:252/252 of 2qedA
Q8ZRM2 Hydroxyacylglutathione hydrolase; Glyoxalase II; Glx II; EC 3.1.2.6 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
42% identity, 100% coverage: 2:258/258 of query aligns to 1:251/251 of Q8ZRM2
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 91% coverage: 2:237/258 of query aligns to 1:241/258 of O24496
Sites not aligning to the query:
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
35% identity, 100% coverage: 2:258/258 of query aligns to 1:255/260 of 1qh5B
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
35% identity, 100% coverage: 2:258/258 of query aligns to 1:255/260 of 1qh5A
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
35% identity, 100% coverage: 2:258/258 of query aligns to 1:255/260 of 1qh3A
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
35% identity, 100% coverage: 2:258/258 of query aligns to 49:303/308 of Q16775
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
28% identity, 86% coverage: 2:224/258 of query aligns to 13:259/283 of 2p18A
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
38% identity, 57% coverage: 25:172/258 of query aligns to 26:172/225 of 4ysbA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 59% coverage: 21:172/258 of query aligns to 75:234/294 of Q9C8L4
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
30% identity, 58% coverage: 22:170/258 of query aligns to 22:185/202 of 7l0bA
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
32% identity, 59% coverage: 21:172/258 of query aligns to 26:185/244 of 2gcuA
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
31% identity, 57% coverage: 23:170/258 of query aligns to 26:198/473 of 3tp9A
4ad9A Crystal structure of human lactb2. (see paper)
31% identity, 59% coverage: 26:176/258 of query aligns to 43:205/288 of 4ad9A
Q53H82 Endoribonuclease LACTB2; Beta-lactamase-like protein 2; EC 3.1.27.- from Homo sapiens (Human) (see paper)
31% identity, 59% coverage: 26:176/258 of query aligns to 43:205/288 of Q53H82
Sites not aligning to the query:
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
30% identity, 68% coverage: 25:200/258 of query aligns to 48:229/254 of O95571
Sites not aligning to the query:
>6937743 FitnessBrowser__SB2B:6937743
MLDIRPIPAFADNYIWMIVLPDGGAVVVDPGDAMPVINTLQRLNLQLTAVLLTHHHRDHN
GGINQLRDWAKSNGQSFTVYGAVTSDYSDVLCRDGDTVDISGLTSPVRVLSVPGHTLDHL
AFVVDNALFCGDTLFSGGCGRLFEGDAGQLYDSLAKLASLPDDTLVYCAHEYTLSNLRFA
LAVEPQNQCLQDYVKQVNNLREANKPSLPSTLGTEKAINPFLRVDTATVHAAVAAQAGQK
VPDEVTCLALLRRWKDNF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory