Comparing 6937802 FitnessBrowser__SB2B:6937802 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
45% identity, 94% coverage: 17:356/362 of query aligns to 7:349/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
45% identity, 94% coverage: 17:356/362 of query aligns to 7:349/354 of 1fg3A
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
43% identity, 94% coverage: 17:356/362 of query aligns to 7:349/353 of 7szpA
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
44% identity, 88% coverage: 40:356/362 of query aligns to 16:335/335 of 1geyA
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
30% identity, 94% coverage: 19:359/362 of query aligns to 5:359/360 of 8bj3A
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
28% identity, 91% coverage: 27:356/362 of query aligns to 14:332/335 of 2f8jA
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
28% identity, 91% coverage: 27:356/362 of query aligns to 8:326/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
28% identity, 91% coverage: 27:356/362 of query aligns to 8:326/329 of 1h1cA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
28% identity, 91% coverage: 27:356/362 of query aligns to 7:325/328 of 1uu0A
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 91% coverage: 27:356/362 of query aligns to 13:331/335 of Q9X0D0
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
31% identity, 83% coverage: 58:359/362 of query aligns to 61:361/366 of 3cq5B
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
31% identity, 83% coverage: 58:359/362 of query aligns to 59:359/364 of 3cq6A
Sites not aligning to the query:
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
30% identity, 96% coverage: 13:361/362 of query aligns to 1:351/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
30% identity, 96% coverage: 13:361/362 of query aligns to 1:351/353 of 4r2nA
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
30% identity, 83% coverage: 58:359/362 of query aligns to 61:361/369 of 4r8dA
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
27% identity, 89% coverage: 40:362/362 of query aligns to 19:351/354 of 3ly1D
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
26% identity, 91% coverage: 29:356/362 of query aligns to 27:361/369 of 4wbtA
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
28% identity, 85% coverage: 53:359/362 of query aligns to 46:353/358 of 1lc7A
Sites not aligning to the query:
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
28% identity, 84% coverage: 53:356/362 of query aligns to 42:346/355 of 1lkcA
Sites not aligning to the query:
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
28% identity, 85% coverage: 53:359/362 of query aligns to 43:350/356 of 1lc8A
Sites not aligning to the query:
>6937802 FitnessBrowser__SB2B:6937802
MTSQVNAVPTDSLAARLARPELLSLEPYQSARRIGGSGEIWVNANESPFNRTGIDGANRY
PECQPPGLIAAYAAYAGVAAHELVCGRGADEAIELLIRTFCVPGQDSIGIFSPTYGMYAI
SAATFNVAVNTLPLAEDFSLPDDISALTGSKLVFVCNPNNPTGTLLPLGEIARVAKTFPN
ALVVVDEAYIEFAHNADGSPAQSATSLMAEFENLVILRTLSKAFGLAGARCGFLLAKPSV
CELVMRVIAPYPVPVPVSVIAEKALSVMGIAQMRADVVLLNKQGARLALALTEAGLSVLP
SGGNYVLAFSNDVEVLARALTKAGIVARRYSHPRLKDAIRISYASEQQTDSIIEAIGRID
SK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory