Comparing 6937822 FitnessBrowser__SB2B:6937822 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3n2oA X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
67% identity, 99% coverage: 6:635/636 of query aligns to 2:630/630 of 3n2oA
3n2oB X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
67% identity, 99% coverage: 6:635/636 of query aligns to 1:629/629 of 3n2oB
3nzqA Crystal structure of biosynthetic arginine decarboxylase adc (spea) from escherichia coli, northeast structural genomics consortium target er600 (see paper)
56% identity, 98% coverage: 13:635/636 of query aligns to 6:624/628 of 3nzqA
Q9SI64 Arginine decarboxylase 1, chloroplastic; ADC 1; ADC-O; ARGDC 1; AtADC1; EC 4.1.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 97% coverage: 3:616/636 of query aligns to 33:630/702 of Q9SI64
3nzpB Crystal structure of the biosynthetic arginine decarboxylase spea from campylobacter jejuni, northeast structural genomics consortium target br53 (see paper)
33% identity, 98% coverage: 13:634/636 of query aligns to 4:579/591 of 3nzpB
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
25% identity, 39% coverage: 95:345/636 of query aligns to 38:271/394 of 3c5qA
Sites not aligning to the query:
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
25% identity, 39% coverage: 95:345/636 of query aligns to 40:273/405 of B4XMC6
Sites not aligning to the query:
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
25% identity, 45% coverage: 67:355/636 of query aligns to 28:289/418 of 4xg1B
Sites not aligning to the query:
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
24% identity, 43% coverage: 83:355/636 of query aligns to 53:310/438 of Q58497
Sites not aligning to the query:
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
24% identity, 43% coverage: 83:355/636 of query aligns to 49:306/434 of 1twiA
Sites not aligning to the query:
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
24% identity, 43% coverage: 83:355/636 of query aligns to 49:306/434 of 1tufA
Sites not aligning to the query:
7kh2D Structure of n-citrylornithine decarboxylase bound with plp (see paper)
25% identity, 40% coverage: 105:359/636 of query aligns to 55:305/415 of 7kh2D
Sites not aligning to the query:
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
24% identity, 38% coverage: 124:364/636 of query aligns to 65:294/412 of 7ru7A
Sites not aligning to the query:
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
23% identity, 41% coverage: 98:360/636 of query aligns to 60:299/422 of 6n2aA
Sites not aligning to the query:
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
24% identity, 31% coverage: 162:355/636 of query aligns to 124:315/446 of 1hkvA
Sites not aligning to the query:
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
24% identity, 31% coverage: 162:355/636 of query aligns to 125:316/447 of P9WIU7
Sites not aligning to the query:
6knhC Crystal structure of sbnh in complex with citrate, a plp-dependent decarboxylase in staphyloferrin b biothesynthesis (see paper)
24% identity, 45% coverage: 70:356/636 of query aligns to 27:273/384 of 6knhC
Sites not aligning to the query:
2nv9B The x-ray crystal structure of the paramecium bursaria chlorella virus arginine decarboxylase (see paper)
25% identity, 22% coverage: 220:357/636 of query aligns to 147:270/372 of 2nv9B
Sites not aligning to the query:
2nvaA The x-ray crystal structure of the paramecium bursaria chlorella virus arginine decarboxylase bound to agmatine (see paper)
25% identity, 22% coverage: 220:357/636 of query aligns to 147:267/369 of 2nvaA
Sites not aligning to the query:
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
28% identity, 28% coverage: 175:355/636 of query aligns to 107:283/419 of 1ko0A
Sites not aligning to the query:
>6937822 FitnessBrowser__SB2B:6937822
MNEWSIDDARAGYNVAHWSQGFYGISDEGEVTVSPDPKNPTFKIGLNALAKDMVKAGVSL
PVLVRFPQILHHRVDHLCQMFNQAIQKYEYQSDYLLVYPIKVNQQQTVVEEILASQVSKT
VPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKDKEYIRLALIGEKLGHSVYIVLEKMS
ELQMVLEESKKLGVTPRLGLRARLAFQGKGKWQASGGEKSKFGLSAAQILKVVERLKDED
MLESLQLLHFHLGSQIANIRDIRHGVGEAARFYCELRKLGAKVNCFDVGGGLAVDYDGTR
SQSNNSMNYALAEYANNIVSVLTDVCNQNEQPMPRIISESGRYLTAHHAVLITDVIGTEA
YSPEDIPAPEEEAPQLLHNMWRSWNEISSRLDQRALIEIFHDTQSDLAEAQSLFALGQLS
LEDRAWAEQCNLAVCHELQGLMNARNRYQRPIIDELNEKLADRFFVNFSLFQSLPDAWGI
DQVFPVLPLSGLDKVPERRAVMLDITCDSDGIVDQYVDGQGIETTLPVPNWSAEDPYLIG
FFLVGAYQEILGDLHNLFGDTNSAVVRIDEEGQTNIESVLAGDTVADVLRYVNLDAVSFM
RTYEELVNSHIAEDERAMILEELQVGLKGYTYLEDF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory