SitesBLAST
Comparing 6937834 FitnessBrowser__SB2B:6937834 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
39% identity, 92% coverage: 3:269/291 of query aligns to 15:280/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (= L9), G22 (= G10), I23 (≠ V11), M24 (= M12), N43 (= N31), R44 (= R32), T45 (= T33), K48 (= K36), V77 (= V66), S78 (≠ G67), D82 (= D71), Q85 (= Q74), V133 (= V122), F244 (= F233), K245 (≠ A234), H248 (≠ W237), K251 (= K240)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
39% identity, 92% coverage: 3:269/291 of query aligns to 15:277/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (= L9), G22 (= G10), I23 (≠ V11), M24 (= M12), N43 (= N31), R44 (= R32), T45 (= T33), K48 (= K36), M76 (≠ C65), V77 (= V66), S78 (≠ G67), D82 (= D71), Q85 (= Q74), V133 (= V122), F241 (= F233), K242 (≠ A234), H245 (≠ W237), K248 (= K240)
- binding sulfate ion: T134 (≠ S123), G135 (= G124), K183 (= K172)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
32% identity, 99% coverage: 1:288/291 of query aligns to 3:291/294 of 5je8B
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
32% identity, 99% coverage: 1:287/291 of query aligns to 1:286/287 of 3pduA
- binding glycerol: R242 (≠ G243), E246 (= E247), E246 (= E247), R250 (= R251)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), G10 (= G10), I11 (≠ V11), M12 (= M12), N31 (= N31), R32 (= R32), N33 (≠ T33), M64 (≠ C65), L65 (≠ V66), A66 (≠ G67), A70 (≠ D71), T96 (= T97), V121 (= V122), G123 (= G124), T124 (≠ G125), K171 (= K172), S231 (≠ G232), F232 (= F233), P233 (≠ A234), H236 (≠ W237), K239 (= K240)
2uyyA Structure of the cytokine-like nuclear factor n-pac
28% identity, 96% coverage: 3:282/291 of query aligns to 8:286/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G10), L16 (≠ V11), M17 (= M12), N36 (= N31), R37 (= R32), T38 (= T33), V70 (= V66), S71 (≠ G67), A75 (≠ D71), T101 (= T97), F237 (= F233), Y238 (≠ A234), Y241 (≠ W237), K244 (= K240)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
27% identity, 96% coverage: 3:282/291 of query aligns to 269:547/553 of Q49A26
- 271:285 (vs. 5:19, 47% identical) binding
- T362 (= T97) binding
- M437 (≠ K172) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (≠ F231) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K240) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
32% identity, 99% coverage: 1:288/291 of query aligns to 1:282/289 of 2cvzC
- active site: S117 (= S123), K165 (= K172), N168 (= N175), N169 (≠ Q176)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), L9 (= L9), G10 (= G10), A11 (≠ V11), M12 (= M12), N30 (= N31), R31 (= R32), T32 (= T33), C62 (= C65), L63 (≠ V66), P64 (≠ G67), E68 (≠ D71), E71 (≠ Q74), S91 (≠ T97), V116 (= V122), F227 (= F233), K234 (= K240)
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
27% identity, 96% coverage: 3:282/291 of query aligns to 268:540/546 of Q922P9
- P489 (≠ F231) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
32% identity, 98% coverage: 3:288/291 of query aligns to 2:281/288 of 1wp4A
- active site: S116 (= S123), K164 (= K172), N167 (= N175), N168 (≠ Q176)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), L8 (= L9), G9 (= G10), A10 (≠ V11), M11 (= M12), N29 (= N31), R30 (= R32), T31 (= T33), K34 (= K36), C61 (= C65), L62 (≠ V66), P63 (≠ G67), E67 (≠ D71), S90 (≠ T97), V115 (= V122), T225 (≠ G232), F226 (= F233), K233 (= K240)
- binding sulfate ion: S116 (= S123), G117 (= G124), G118 (= G125), K164 (= K172)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
30% identity, 98% coverage: 3:288/291 of query aligns to 3:287/287 of 3pefA
- binding glycerol: D67 (≠ N68), G123 (= G124), K171 (= K172), N175 (≠ Q176), M178 (≠ I179), L203 (≠ V204), G207 (≠ S208), N213 (= N219), A217 (≠ S223), F232 (= F233), H236 (≠ W237), K239 (= K240), R242 (≠ G243), R269 (≠ Q270)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), I11 (≠ V11), M12 (= M12), N31 (= N31), R32 (= R32), S33 (≠ T33), K36 (= K36), M64 (≠ C65), L65 (≠ V66), A66 (≠ G67), A70 (≠ D71), E73 (≠ Q74), T96 (= T97), V121 (= V122), G123 (= G124), S124 (≠ G125), A231 (≠ G232), F232 (= F233), H236 (≠ W237), K239 (= K240)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
29% identity, 98% coverage: 3:288/291 of query aligns to 40:331/335 of P29266
- D68 (≠ N31) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K172) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q176) mutation to Q: Decrease in activity.
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
30% identity, 99% coverage: 1:289/291 of query aligns to 1:289/298 of P0A9V8
- QM 11:12 (≠ VM 11:12) binding
- D31 (≠ N31) binding
- L65 (≠ V66) binding
- T96 (= T97) binding
- G122 (≠ S123) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G124) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G125) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQICI 175:179) binding
- K240 (= K240) binding
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
30% identity, 99% coverage: 2:289/291 of query aligns to 1:288/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), Q10 (≠ V11), M11 (= M12), F29 (≠ Y30), D30 (≠ N31), V31 (≠ T33), M63 (≠ C65), L64 (≠ V66), V73 (= V75), S94 (≠ T96), T95 (= T97), R122 (≠ G124)
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
30% identity, 99% coverage: 2:289/291 of query aligns to 1:288/294 of 6smyA
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
28% identity, 98% coverage: 3:288/291 of query aligns to 41:332/336 of P31937
- LP 103:104 (≠ VG 66:67) binding
- N108 (≠ D71) binding
- T134 (= T97) binding
- K284 (= K240) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
28% identity, 98% coverage: 3:288/291 of query aligns to 2:293/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), N10 (≠ V11), M11 (= M12), Y29 (= Y30), D30 (≠ N31), V31 (≠ R32), M63 (≠ C65), L64 (≠ V66), P65 (≠ G67), T95 (= T97), V120 (= V122), G122 (= G124), F238 (= F233), K245 (= K240)
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
27% identity, 96% coverage: 6:285/291 of query aligns to 320:599/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
30% identity, 84% coverage: 1:244/291 of query aligns to 1:250/298 of Q9I5I6
- 2:31 (vs. 2:31, 50% identical) binding
- P66 (≠ G67) binding
- T96 (= T97) binding ; mutation to A: Almost abolished activity.
- S122 (= S123) mutation to A: Strongly reduced activity.
- K171 (= K172) active site
- N175 (≠ Q176) mutation to A: Strongly reduced activity.
- W214 (= W215) mutation to A: Almost abolished activity.
- Y219 (≠ K222) mutation to A: Strongly reduced activity.
- K246 (= K240) binding ; mutation to A: Almost abolished activity.
- D247 (= D241) mutation to A: Almost abolished activity.
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
30% identity, 84% coverage: 1:244/291 of query aligns to 1:249/295 of 3obbA
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
30% identity, 83% coverage: 3:244/291 of query aligns to 2:248/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), H10 (≠ V11), M11 (= M12), F29 (≠ Y30), D30 (≠ N31), L31 (≠ R32), M63 (≠ C65), L64 (≠ V66), P65 (≠ G67), T94 (= T97), V119 (= V122), G121 (= G124), F237 (= F233), K244 (= K240)
Query Sequence
>6937834 FitnessBrowser__SB2B:6937834
MAKVAFLGLGVMGYPMAGHLVKAGHQVTVYNRTTAKAEAWVKQFGGAMALSPKLAAEDQD
IVFTCVGNDKDLHQVVLGEDGVIHGLNAGAVLVDHTTASADIAREIGAALNAQGFGFVDA
PVSGGQAGAENGVLTVMAGGDEAVFNQVKDVIMSYARCAERLGETGAGQLTKMVNQICIA
GVVQGLAEALHFARSAGLDGEKVVEVISKGAAQSWQMENRYKSMWAGEYNFGFAIDWMRK
DLGIALEEARRNGSHLPLTALVDQFYSEVQGMGGNRWDTSSLMARLEKSRK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory