Comparing 6937867 FitnessBrowser__SB2B:6937867 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
52% identity, 98% coverage: 1:391/401 of query aligns to 4:397/398 of 8sadA
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
52% identity, 95% coverage: 10:391/401 of query aligns to 5:391/392 of 8sabA
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
52% identity, 95% coverage: 10:391/401 of query aligns to 4:390/391 of 8u99A
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
52% identity, 95% coverage: 10:391/401 of query aligns to 4:390/391 of 8u98A
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
52% identity, 95% coverage: 10:391/401 of query aligns to 4:390/391 of 8sa9A
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
51% identity, 98% coverage: 1:391/401 of query aligns to 1:394/395 of P06721
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
51% identity, 96% coverage: 7:391/401 of query aligns to 2:391/392 of 1cl1B
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
51% identity, 96% coverage: 7:391/401 of query aligns to 1:390/391 of 2gqnA
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
51% identity, 96% coverage: 7:391/401 of query aligns to 1:390/391 of 2fq6A
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
51% identity, 96% coverage: 7:391/401 of query aligns to 1:390/391 of 1cl2A
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
51% identity, 96% coverage: 7:391/401 of query aligns to 1:390/391 of 4itxA
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
34% identity, 96% coverage: 6:391/401 of query aligns to 1:373/373 of 4l0oH
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
34% identity, 96% coverage: 6:388/401 of query aligns to 1:376/377 of 7d7oB
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
32% identity, 94% coverage: 10:384/401 of query aligns to 10:388/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
32% identity, 94% coverage: 10:384/401 of query aligns to 10:388/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
32% identity, 94% coverage: 10:384/401 of query aligns to 10:388/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
32% identity, 94% coverage: 10:384/401 of query aligns to 10:388/396 of 3jw9A
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
32% identity, 94% coverage: 10:384/401 of query aligns to 10:388/396 of 6egrA
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
32% identity, 94% coverage: 10:384/401 of query aligns to 9:387/395 of 5m3zA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
32% identity, 94% coverage: 10:384/401 of query aligns to 10:388/396 of 4hf8A
>6937867 FitnessBrowser__SB2B:6937867
MSDKPMKTATKIVSLGREKKYSKGVINPPVFRASTIVFDTMEEMRHAAKNKHNGEMFYGR
RGTPTHFGFQAAIAELEGGAGTALYPSGAAAISASLLAFLQAGDHLLMVDSVYEPTRDLC
DKVLKGYGIETTYYDPLIGAGIEALIRPNTRVLFVESPGSITMEVQDVPTLARIAHEHGL
VVILDNTWASPINSRPFELGVDVSIQAATKYIVGHSDVMMGTATASPQYWDKLREHSYLL
GQTTSPDDVYLAARGLRTLGVRMAQHEKNALAVANWLKTRPEVDHLRHPAFEECPGHEFF
KRDFSGSNGLFSFVLKRGTVDAVTAMVEGMSHFKMGFSWGGFESLILGVTGIHNIRSATR
WDSSKPLIRVHIGLEDPEDLIEDLSAGFVRFNEVMAKETQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory