SitesBLAST
Comparing 6937936 FitnessBrowser__SB2B:6937936 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
27% identity, 84% coverage: 29:387/429 of query aligns to 3:346/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I33), G8 (= G34), G10 (= G36), V11 (≠ F37), I12 (≠ T38), V30 (≠ L56), E31 (= E57), K32 (≠ A58), E38 (≠ G64), A39 (= A65), S40 (≠ T66), A43 (≠ N69), G45 (= G71), L46 (≠ Q72), V171 (= V211), G200 (= G238), G201 (≠ N239), W203 (≠ Y241), G298 (= G341), R300 (≠ A343), P301 (≠ G344), Y326 (≠ S367), R327 (≠ G368), N328 (≠ H369), G329 (= G370), I330 (≠ V371)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
21% identity, 86% coverage: 27:395/429 of query aligns to 24:381/383 of 5i39A
- active site: F66 (≠ N69), Q69 (= Q72), A70 (≠ V73), Q248 (≠ D283), P267 (≠ G302)
- binding flavin-adenine dinucleotide: V30 (≠ I33), G31 (= G34), G33 (= G36), I34 (≠ F37), L35 (≠ T38), V53 (≠ L56), E54 (= E57), K55 (≠ A58), Q62 (≠ A65), S63 (≠ T66), F66 (≠ N69), Y67 (≠ G70), Q69 (= Q72), A196 (≠ Q210), A197 (≠ V211), G226 (= G238), G227 (≠ N239), W229 (≠ Y241), Q248 (≠ D283), Q250 (≠ R285), G321 (= G341), M323 (≠ A343), T348 (≠ S367), G349 (= G368), W350 (≠ H369), G351 (= G370), M352 (≠ V371), T353 (≠ A372)
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
24% identity, 51% coverage: 27:244/429 of query aligns to 16:224/433 of 5hxwA
- active site: F58 (≠ N69), Q61 (= Q72), A62 (≠ V73)
- binding flavin-adenine dinucleotide: V22 (≠ I33), G23 (= G34), G25 (= G36), I26 (≠ F37), L27 (≠ T38), E46 (= E57), K47 (≠ A58), E53 (≠ G64), Q54 (≠ A65), S55 (≠ T66), R57 (= R68), F58 (≠ N69), Y59 (≠ G70), G60 (= G71), Q61 (= Q72), A188 (≠ Q210), A189 (≠ V211), G218 (= G238), G219 (≠ N239), W221 (≠ Y241)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
22% identity, 81% coverage: 40:388/429 of query aligns to 17:349/369 of S5FMM4
- G51 (≠ T74) mutation to S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- A54 (≠ L77) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- K81 (≠ E96) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (vs. gap) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ V371) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (= M381) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Query Sequence
>6937936 FitnessBrowser__SB2B:6937936
MQARCGSYYNATIKHETDYPRLTEAIQADVAVIGGGFTGVNTALELAEQGYKVVLLEANK
IAWGATGRNGGQVTGSLSGDQAMTKQLRNRIGAEAEDYVWALRWRGHDIIKNRVAKYNID
CDLRHGHLHTAYKPAHMNELKSMLDEAQRKGMGDLVSLVEKDEMPQYLESPLYHGGLLNK
KNMHLHSVNLCIGEARAAESLGVRIFEDTQVLDIVEGPRPVVKTAFGSVTANKVLIAGNA
YHKLGRPKLRGMLFPASLGNCATVRLSDEVASAINPHNLAVYDCRFVLDYYRLTADNRLM
FGGGTNYSGRDPKNVAEELRPAIERTFPRLKGVEIEFAWAGMAGIVINRIPQLGKVSEHV
YYCQGYSGHGVATSHIMSEIMAKAIDGDLREFGLFAGMKHWRIPLNEWFGNQALAIGMLY
YQLRESLRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory