Comparing 6938088 FitnessBrowser__SB2B:6938088 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
79% identity, 95% coverage: 17:338/339 of query aligns to 15:336/336 of A3QCW5
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
31% identity, 90% coverage: 34:338/339 of query aligns to 4:308/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
31% identity, 90% coverage: 34:338/339 of query aligns to 3:307/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
31% identity, 90% coverage: 34:338/339 of query aligns to 3:307/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
31% identity, 90% coverage: 34:338/339 of query aligns to 3:307/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
31% identity, 90% coverage: 34:338/339 of query aligns to 3:307/310 of 7bcnA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
31% identity, 86% coverage: 44:336/339 of query aligns to 13:303/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
31% identity, 86% coverage: 44:336/339 of query aligns to 12:302/303 of 4p9kA
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
26% identity, 90% coverage: 19:322/339 of query aligns to 10:312/328 of Q0B2F6
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
28% identity, 88% coverage: 38:335/339 of query aligns to 4:299/303 of 4pddA
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
27% identity, 80% coverage: 53:322/339 of query aligns to 17:286/301 of 4n17A
Sites not aligning to the query:
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
27% identity, 80% coverage: 53:322/339 of query aligns to 17:286/301 of 4n15A
Sites not aligning to the query:
7t3eA Structure of the sialic acid bound tripartite atp-independent periplasmic (trap) periplasmic component siap from photobacterium profundum (see paper)
31% identity, 78% coverage: 67:331/339 of query aligns to 34:295/300 of 7t3eA
Sites not aligning to the query:
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
28% identity, 88% coverage: 37:336/339 of query aligns to 4:310/314 of 4p8bA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
27% identity, 90% coverage: 22:327/339 of query aligns to 12:315/329 of P44542
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
27% identity, 82% coverage: 57:335/339 of query aligns to 23:302/305 of 4mnpA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
26% identity, 75% coverage: 67:321/339 of query aligns to 32:284/300 of 4n8yA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
27% identity, 79% coverage: 53:321/339 of query aligns to 25:287/304 of 4x8rA
Sites not aligning to the query:
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
26% identity, 86% coverage: 37:327/339 of query aligns to 4:292/310 of 3b50A
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
26% identity, 86% coverage: 37:327/339 of query aligns to 4:292/309 of 2v4cA
>6938088 FitnessBrowser__SB2B:6938088
MKVSKPATLQSLFTLGKASLLATVLGFSFGAVAEPVEIKFSHVVAENTPKGQMALKFKEL
VESRLPGEYKVSVFPNSQLFGDNNELAALLLNDVQLVAPSLSKFERYTKKLQVFDLPFLF
EDMDAVDRFQQSEAGQQLLNSMSRKGLVGLGYLHNGMKQFSANNALSLPGDAAGKKFRIM
PSDVIAAQFEAVGAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQTHITESNH
GVLDYMLVTSETFWKSLPKDKREIIKQSMDEAVALGNKLALEKANEDRQLILDSKRVELV
TLTPEQRQAWVNAMRPVWSQFEDKIGKDLIEAAESANKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory