Comparing 6938098 FitnessBrowser__SB2B:6938098 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
59% identity, 100% coverage: 1:327/328 of query aligns to 7:342/343 of 3lzkC
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
28% identity, 73% coverage: 67:307/328 of query aligns to 78:290/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
28% identity, 73% coverage: 67:307/328 of query aligns to 79:291/303 of 8sutA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
31% identity, 48% coverage: 109:265/328 of query aligns to 93:243/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
31% identity, 48% coverage: 109:265/328 of query aligns to 93:243/290 of 8gsrA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
28% identity, 64% coverage: 55:265/328 of query aligns to 45:242/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
28% identity, 64% coverage: 55:265/328 of query aligns to 45:242/280 of 6j5xA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
30% identity, 49% coverage: 104:265/328 of query aligns to 77:226/265 of 3r6oA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
24% identity, 60% coverage: 68:265/328 of query aligns to 57:240/277 of 6iymA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
23% identity, 66% coverage: 69:286/328 of query aligns to 52:254/269 of 4dbhA
>6938098 FitnessBrowser__SB2B:6938098
MKLATYNNGRRDGQLMLVSRDLTKAVAVPAIAHTMQQLLDAWALLSPQLTELYDALNAGQ
LENTVDFDETKCLSPFPRAFQWADGSAYVNHVELVRKARGAEMPDTFWTDPLFYQGGSDS
FIPPRSNIEMGSEDWGIDFESEIAVVTDDVPMGISAENAASHIKLLMLVNDVSLRNLIPA
ELAKGFGFFQSKPSSSFSPVAVTPDELGDKWQDSKVHLPLITHLNGELFGKPNAGVDMTF
NFSQLVAHVTKTRPLGAGAIIGSGTISNYDRSAGSSCLAEKRMLEVIADGKASTPFMRFG
DRVRIEMLDDAGNSIFGAIDQQVVEYKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory