Comparing 6938111 FitnessBrowser__SB2B:6938111 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9Z1N4 3'(2'),5'-bisphosphate nucleotidase 1; Bisphosphate 3'-nucleotidase 1; PAP-inositol 1,4-phosphatase; PIP; scHAL2 analogous 3; EC 3.1.3.7 from Rattus norvegicus (Rat) (see paper)
29% identity, 83% coverage: 35:268/281 of query aligns to 18:280/308 of Q9Z1N4
Sites not aligning to the query:
2wefA Human 3'(2'), 5'-bisphosphate nucleotidase 1 (bpnt1) in complex with amp, po4 and magnesium
27% identity, 83% coverage: 35:268/281 of query aligns to 13:275/303 of 2wefA
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
29% identity, 76% coverage: 36:249/281 of query aligns to 12:227/262 of 2qflA
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 76% coverage: 36:249/281 of query aligns to 12:227/267 of P0ADG4
Sites not aligning to the query:
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
29% identity, 76% coverage: 36:249/281 of query aligns to 16:231/270 of 6ib8B
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
29% identity, 76% coverage: 35:247/281 of query aligns to 13:231/274 of 4as5A
2p3nA Thermotoga maritima impase tm1415 (see paper)
25% identity, 83% coverage: 29:261/281 of query aligns to 4:230/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
25% identity, 83% coverage: 29:261/281 of query aligns to 4:230/256 of O33832
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
29% identity, 78% coverage: 41:258/281 of query aligns to 8:231/259 of 2cziA
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
29% identity, 76% coverage: 35:247/281 of query aligns to 15:233/277 of O55023
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 77% coverage: 33:249/281 of query aligns to 22:236/271 of Q9M8S8
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 72% coverage: 47:249/281 of query aligns to 24:228/260 of P95189
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
31% identity, 77% coverage: 35:249/281 of query aligns to 10:226/256 of 5zonA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
31% identity, 77% coverage: 35:249/281 of query aligns to 9:225/255 of 5yhtA
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
29% identity, 80% coverage: 34:258/281 of query aligns to 25:254/288 of O14732
6tqoT Rrn anti-termination complex (see paper)
28% identity, 76% coverage: 36:249/281 of query aligns to 12:219/255 of 6tqoT
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
27% identity, 78% coverage: 29:247/281 of query aligns to 5:229/266 of 1imdA
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
27% identity, 78% coverage: 29:247/281 of query aligns to 5:229/272 of 2hhmA
1qgxA X-ray structure of yeast hal2p (see paper)
24% identity, 82% coverage: 46:275/281 of query aligns to 27:334/354 of 1qgxA
1ka1A The papase hal2p complexed with calcium and magnesium ions and reaction substrate: pap (see paper)
24% identity, 82% coverage: 46:275/281 of query aligns to 27:334/354 of 1ka1A
>6938111 FitnessBrowser__SB2B:6938111
MAVFAWPEHHGPQVAGGYMTLVALDKTTLDKLGQIARQAGAAIMAVYGQGDVAVTQKSDD
SPVTAADLASHTVIIEQLAAAFPFTPVLSEEAVIDWETRRQWQEYFLIDPLDGTKEFIKR
NGEFTVNIALVRDGIAVAGVVFAPVLDTCYLGAEGLGAWLECQGKQQPLQGSAQKRDVPV
VVGSRSHQSAEMAGYLADLGDHELLSVGSSLKFCMLAEGRADLYPRLGPTSEWDTAAAQA
VLESAGGRVVVYGESNPLVYNKKEQLLNPWFMATAPGWNTH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory