Comparing 6938119 FitnessBrowser__SB2B:6938119 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
68% identity, 93% coverage: 16:299/305 of query aligns to 2:285/294 of 4ho9A
4ho6A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-glucose and utp
68% identity, 93% coverage: 16:299/305 of query aligns to 2:285/288 of 4ho6A
4ho5A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with tdp-glucose
68% identity, 93% coverage: 16:299/305 of query aligns to 2:285/288 of 4ho5A
4ho3A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine triphosphate
68% identity, 93% coverage: 16:299/305 of query aligns to 2:285/288 of 4ho3A
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
68% identity, 93% coverage: 16:299/305 of query aligns to 2:285/289 of 4ho4A
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
65% identity, 93% coverage: 16:300/305 of query aligns to 3:287/293 of 5ifyA
4hocA Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n- acetylglucosamine
67% identity, 93% coverage: 16:299/305 of query aligns to 2:283/286 of 4hocA
P61887 Glucose-1-phosphate thymidylyltransferase 2; G1P-TT 2; dTDP-glucose pyrophosphorylase 2; dTDP-glucose synthase 2; EC 2.7.7.24 from Escherichia coli (strain K12) (see paper)
65% identity, 93% coverage: 16:300/305 of query aligns to 2:286/293 of P61887
1mc3A Crystal structure of rffh (see paper)
65% identity, 93% coverage: 16:300/305 of query aligns to 3:287/291 of 1mc3A
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
64% identity, 94% coverage: 16:302/305 of query aligns to 5:291/295 of 6n0uA
1lvwA Crystal structure of glucose-1-phosphate thymidylyltransferase, rmla, complex with dtdp
64% identity, 93% coverage: 16:299/305 of query aligns to 5:288/295 of 1lvwA
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
63% identity, 97% coverage: 6:300/305 of query aligns to 3:297/302 of 4b2xB
4b5bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 94% coverage: 14:300/305 of query aligns to 2:288/293 of 4b5bA
4b4gA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 94% coverage: 14:300/305 of query aligns to 2:288/293 of 4b4gA
4b42A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 94% coverage: 14:300/305 of query aligns to 2:288/293 of 4b42A
4b3uA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 94% coverage: 14:300/305 of query aligns to 8:294/299 of 4b3uA
4asyA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 94% coverage: 14:300/305 of query aligns to 2:288/293 of 4asyA
5fyeA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
64% identity, 94% coverage: 13:300/305 of query aligns to 4:291/296 of 5fyeA
5fu0A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
64% identity, 94% coverage: 13:300/305 of query aligns to 4:291/296 of 5fu0A
5ftvA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
64% identity, 94% coverage: 13:300/305 of query aligns to 4:291/296 of 5ftvA
>6938119 FitnessBrowser__SB2B:6938119
MSLNIQHSAFNTQKTKGIILAGGTGSRLYPITRGVSKQLLPVYDKPMVYYPLSVLMLAGI
RDILLISTASDLAGFQSLLGDGSGLGIRISYAVQSKPEGIAQAFLIGEDFIGNDKVALIL
GDNIFYGQSFSRQLQQAADCSLGATVFAYHVTNPERFGVVEFDNTGRAVSIEEKPREPKS
HYAVTGLYFYDNQVIEFAKSLRPSARGELEITDINNAYLAANQLQVSVLGRGFAWLDTGT
HDALMEAGHFVQTIEKRQGLKIACLEEIAYRNGWISTETLLQHAKALSQSGYGDYLRQLV
WDASL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory