SitesBLAST
Comparing 6938123 FitnessBrowser__SB2B:6938123 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
47% identity, 50% coverage: 258:582/644 of query aligns to 2:311/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G287), G34 (= G290), T35 (≠ S291), I36 (= I292), D56 (≠ E312), H57 (≠ L313), S82 (= S344), I83 (≠ V345), A104 (= A366), A105 (= A367), A106 (= A368), K108 (= K370), N123 (= N385), I146 (= I408), K162 (= K424), F184 (= F448), G185 (= G449), N186 (= N450), V187 (= V451), S190 (= S454), S191 (= S455)
- binding uridine-5'-diphosphate: K150 (= K412), N186 (= N450), S193 (= S457), V194 (= V458), T209 (= T473), L210 (≠ V474), T211 (= T475), I215 (= I479), R217 (= R481), E279 (= E552)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
45% identity, 55% coverage: 258:610/644 of query aligns to 2:331/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G287), G34 (= G290), T35 (≠ S291), I36 (= I292), D56 (≠ E312), H57 (≠ L313), S82 (= S344), I83 (≠ V345), A104 (= A366), A105 (= A367), A106 (= A368), K108 (= K370), N123 (= N385), I146 (= I408), K162 (= K424), F184 (= F448), G185 (= G449), N186 (= N450), V187 (= V451), S190 (= S454), S191 (= S455)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K370), H109 (= H371), T148 (= T410), G185 (= G449), N186 (= N450), S193 (= S457), V194 (= V458), T209 (= T473), L210 (≠ V474), T211 (= T475), I215 (= I479), R217 (= R481), R276 (= R549), E279 (= E552)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
36% identity, 44% coverage: 281:562/644 of query aligns to 6:275/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G287), T14 (≠ G289), G15 (= G290), T16 (≠ S291), I17 (= I292), S37 (≠ E312), R38 (≠ L313), S39 (= S314), D63 (≠ S344), I64 (≠ V345), V83 (≠ A366), A84 (= A367), K87 (= K370), T125 (≠ I408), S127 (≠ T410), Y137 (≠ M420), K141 (= K424), F167 (= F448), V170 (= V451), S173 (= S454), R174 (≠ S455)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K370), H88 (= H371), S127 (≠ T410), N128 (≠ D411), Y137 (≠ M420), N169 (= N450), S176 (= S457), V177 (= V458), L180 (= L461), T192 (= T473), T194 (= T475), M198 (≠ I479), R200 (= R481), L234 (≠ I516), E265 (= E552)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
34% identity, 49% coverage: 281:593/644 of query aligns to 5:309/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G287), T13 (≠ G289), G14 (= G290), S15 (= S291), F16 (≠ I292), S36 (≠ E312), R37 (≠ L313), D38 (≠ S314), K41 (≠ G317), D60 (≠ S344), V61 (= V345), A80 (= A366), A81 (= A367), A82 (= A368), K84 (= K370), T99 (≠ N385), L122 (≠ I408), K138 (= K424), Y164 (≠ F448)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
33% identity, 50% coverage: 269:589/644 of query aligns to 4:333/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G287), T22 (≠ G289), G23 (= G290), S24 (= S291), F25 (≠ I292), S45 (≠ E312), R46 (≠ L313), D47 (≠ S314), K50 (≠ E324), D69 (≠ S344), V70 (= V345), A89 (= A366), A90 (= A367), A91 (= A368), K93 (= K370), L131 (≠ I408), T133 (= T410), K147 (= K424), Y173 (≠ F448)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ H371), V95 (= V372), K135 (= K412), N175 (= N450), S182 (= S457), V183 (= V458), L186 (= L461), T198 (= T473), T200 (= T475), M204 (≠ I479), V240 (≠ I516), R263 (= R549), E266 (= E552), Y278 (vs. gap), S313 (≠ A575), Y314 (≠ H576), E315 (= E577), Y316 (≠ V578), N320 (vs. gap)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
33% identity, 50% coverage: 269:589/644 of query aligns to 4:333/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K370), Q94 (≠ H371), N175 (= N450), S179 (= S454), R180 (≠ S455), S182 (= S457), V183 (= V458), L186 (= L461), T198 (= T473), I199 (≠ V474), T200 (= T475), M204 (≠ I479), R206 (= R481), V240 (≠ I516), R263 (= R549), E266 (= E552)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
35% identity, 43% coverage: 281:559/644 of query aligns to 6:265/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G287), T14 (≠ G289), G15 (= G290), F17 (≠ I292), S37 (≠ E312), R38 (≠ L313), D39 (≠ S314), K42 (≠ E324), D61 (≠ S344), V62 (= V345), R63 (≠ Q346), A81 (= A366), A82 (= A367), A83 (= A368), K85 (= K370), S124 (= S409), T125 (= T410), K139 (= K424), Y165 (≠ F448), G166 (= G449)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
30% identity, 44% coverage: 278:562/644 of query aligns to 2:265/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G287), T13 (≠ G289), G14 (= G290), S15 (= S291), F16 (≠ I292), S37 (≠ E312), R38 (≠ L313), D39 (≠ S314), K42 (≠ G317), D61 (≠ S344), V62 (= V345), A81 (= A366), A82 (= A367), A83 (= A368), K85 (= K370), T100 (≠ N385), L123 (≠ I408), S124 (= S409), K139 (= K424), Y165 (≠ F448), G166 (= G449), V168 (= V451), S171 (= S454), R172 (≠ S455)
- binding uridine-5'-diphosphate: K127 (= K412), N167 (= N450), V175 (= V458), P191 (≠ T473), I192 (≠ V474), T193 (= T475), M197 (≠ I479), R199 (= R481), M233 (≠ I516), R252 (= R549)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
30% identity, 44% coverage: 278:562/644 of query aligns to 8:271/333 of O25511
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
30% identity, 44% coverage: 278:562/644 of query aligns to 4:267/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K370), S176 (= S457), V177 (= V458), T195 (= T475), M199 (≠ I479), R201 (= R481), M235 (≠ I516), R254 (= R549), E257 (= E552)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G287), T15 (≠ G289), G16 (= G290), S17 (= S291), F18 (≠ I292), S39 (≠ E312), R40 (≠ L313), D41 (≠ S314), K44 (≠ G317), D63 (≠ S344), V64 (= V345), A83 (= A366), A84 (= A367), A85 (= A368), K87 (= K370), L125 (≠ I408), S126 (= S409), Y137 (≠ M420), K141 (= K424), Y167 (≠ F448), G168 (= G449), V170 (= V451)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
30% identity, 44% coverage: 278:562/644 of query aligns to 4:267/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G287), T15 (≠ G289), G16 (= G290), S17 (= S291), F18 (≠ I292), R40 (≠ L313), D41 (≠ S314), K44 (≠ G317), D63 (≠ S344), V64 (= V345), A83 (= A366), A84 (= A367), A85 (= A368), K87 (= K370), L125 (≠ I408), S126 (= S409), K141 (= K424), Y167 (≠ F448), G168 (= G449), V170 (= V451), R174 (≠ S455)
- binding uridine-5'-diphosphate-glucose: K87 (= K370), T127 (= T410), K129 (= K412), Y137 (≠ M420), N169 (= N450), S176 (= S457), V177 (= V458), P193 (≠ T473), T195 (= T475), M199 (≠ I479), R201 (= R481), M235 (≠ I516), R254 (= R549), E257 (= E552)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
30% identity, 44% coverage: 278:562/644 of query aligns to 4:267/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G287), T15 (≠ G289), G16 (= G290), S17 (= S291), F18 (≠ I292), R40 (≠ L313), D41 (≠ S314), K44 (≠ G317), D63 (≠ S344), V64 (= V345), A84 (= A367), A85 (= A368), K87 (= K370), S126 (= S409), Y137 (≠ M420), K141 (= K424), Y167 (≠ F448), G168 (= G449), V170 (= V451), S173 (= S454), R174 (≠ S455)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K370), D128 (= D411), K129 (= K412), N169 (= N450), G175 (= G456), S176 (= S457), V177 (= V458), P193 (≠ T473), I194 (≠ V474), M199 (≠ I479), R201 (= R481), M235 (≠ I516), R254 (= R549), E257 (= E552)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
30% identity, 44% coverage: 278:562/644 of query aligns to 4:267/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G287), T15 (≠ G289), G16 (= G290), S17 (= S291), F18 (≠ I292), S39 (≠ E312), R40 (≠ L313), D41 (≠ S314), K44 (≠ G317), D63 (≠ S344), V64 (= V345), A83 (= A366), A84 (= A367), A85 (= A368), K87 (= K370), T102 (≠ N385), L125 (≠ I408), S126 (= S409), T127 (= T410), Y137 (≠ M420), K141 (= K424), Y167 (≠ F448), G168 (= G449), V170 (= V451), S173 (= S454), R174 (≠ S455)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K370), T127 (= T410), D128 (= D411), K129 (= K412), Y137 (≠ M420), N169 (= N450), S176 (= S457), V177 (= V458), P193 (≠ T473), T195 (= T475), M199 (≠ I479), R201 (= R481), M235 (≠ I516), R254 (= R549), E257 (= E552)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
27% identity, 42% coverage: 261:530/644 of query aligns to 5:279/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G290), S41 (= S291), I42 (= I292), D62 (≠ E312), I63 (≠ L313), D92 (vs. gap), I93 (≠ M342), L114 (≠ A366), S115 (≠ A367), A116 (= A368), K118 (= K370), V158 (≠ I408), D161 (= D411), K174 (= K424), V198 (= V451), S201 (= S454)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
30% identity, 35% coverage: 281:507/644 of query aligns to 4:198/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G287), T12 (≠ G289), G13 (= G290), S14 (= S291), F15 (≠ I292), S35 (≠ E312), R36 (≠ L313), D37 (≠ S314), K40 (≠ E324), D59 (≠ S344), V60 (= V345), A80 (= A367), A81 (= A368), K83 (= K370), L121 (≠ I408), T123 (= T410), K137 (= K424), Y163 (≠ F448), G164 (= G449)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
27% identity, 38% coverage: 261:506/644 of query aligns to 3:236/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G290), S39 (= S291), I40 (= I292), D60 (≠ E312), I61 (≠ L313), L89 (≠ M341), D90 (vs. gap), I91 (≠ M342), L112 (≠ A366), S113 (≠ A367), A114 (= A368), K116 (= K370), D159 (= D411), K172 (= K424), N195 (= N450), V196 (= V451), S199 (= S454)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
25% identity, 44% coverage: 276:559/644 of query aligns to 1:246/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G287), S14 (≠ G289), G15 (= G290), S16 (= S291), L17 (≠ I292), R36 (≠ L313), D37 (≠ S314), D59 (≠ S344), I60 (≠ V345), A81 (= A366), A82 (= A367), A83 (= A368), K85 (= K370), V128 (≠ I408), Y140 (≠ M420), K144 (= K424), Y168 (≠ F448), G169 (= G449), V171 (= V451)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
29% identity, 27% coverage: 280:454/644 of query aligns to 1:181/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G287), G11 (= G290), Y12 (≠ S291), I13 (= I292), D32 (≠ F311), N33 (≠ E312), S35 (= S314), G37 (≠ F316), D57 (≠ E337), L58 (= L338), F79 (≠ A366), A80 (= A367), I83 (≠ K370), N98 (= N385), Y147 (≠ M420), K151 (= K424), Y175 (≠ F448), N177 (= N450), V178 (= V451)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
23% identity, 42% coverage: 281:550/644 of query aligns to 9:286/667 of Q9LPG6
- G18 (= G290) mutation to A: Abolishes dehydratase activity.
- K36 (= K307) mutation to A: Reduces dehydratase activity.
- D96 (≠ P373) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K424) mutation to A: Abolishes dehydratase activity.
- G193 (= G453) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
23% identity, 43% coverage: 276:550/644 of query aligns to 2:284/669 of Q9SYM5
- R283 (= R549) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
Query Sequence
>6938123 FitnessBrowser__SB2B:6938123
MDFFQFLFSLKRPHKRMVSVAVDSVFLVLSFWFALFVRLDSVEVVLNSQFWLLIALVCPV
SIAAFVKLGLYRAVLRYLGTQAMTAIVLGVIVSTLAMVSFAYFLSVDLPRTVPFIFASFA
LVFVGGARALMRSLVGNGINRRGEPVIIYGAGVSGRQTALALAQSHEYHPFAFVDDDETL
HGTVIQGLHVHSPSIIKKLIKQQKASRVLLAMPSASRARRQQILQTLEPLSVKVMTLPAM
ADLVSGNKLFSDVKEVEIEDLLGRDAVAPRKDLMAANITGKVVMVTGAGGSIGSELCRQI
LRLAPRKLVLFELSEFGLYSIERELQAIRAELGLDVELFPMMGSVQRQNRVQAVMEAFKV
QTVYHAAAYKHVPLVEHNVVEGVRNNVFGTLYTAQAAIATGVETFVLISTDKAVRPTNVM
GTTKRMAELVLQALSKLNSGTRFCMVRFGNVLGSSGSVVPLFRKQIANGGPVTVTHPEIT
RFFMTIPEASQLVIQAGAMGIGGDVFVLDMGQSVKIVDLARKMIRLSGFEVKDEHNPDGD
IEIQFSGLRPGEKLYEELLIGDNVEGTGHERIMTAHEVFLTWEELKPVLDKLDMACHAFD
HESIRELMLKAPTGFNPTDGICDLVWLNRRHVEDRSNVVALKGQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory