SitesBLAST
Comparing 6938129 FitnessBrowser__SB2B:6938129 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P14697 Acetoacetyl-CoA reductase; EC 1.1.1.36 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see 2 papers)
45% identity, 100% coverage: 1:242/243 of query aligns to 1:245/246 of P14697
- GGI 13:15 (= GGI 13:15) binding
- G35 (≠ T34) binding
- R40 (≠ Q39) binding
- Q47 (≠ M48) mutation to L: 2.4-fold increase in activity. 2-fold decrease in affinity for NADPH and 2.8-fold decrease in affinity for acetoacetyl-CoA.
- GNV 60:62 (≠ SNV 60:62) binding
- NAGIT 88:92 (≠ NLGIT 85:89) binding
- D94 (= D91) mutation to A: About 6% of wild-type activity.
- K99 (= K96) mutation to A: Nearly loss of activity.
- Q147 (= Q144) mutation to A: About 30% of wild-type activity.
- F148 (= F145) mutation to A: About 30% of wild-type activity.
- Q150 (= Q147) mutation to A: About 20% of wild-type activity.
- T173 (≠ K170) mutation to S: 3.5-fold increase in activity. 4-fold decrease in affinity for NADPH and 2.4-fold decrease in affinity for acetoacetyl-CoA.
- PGYI 183:186 (≠ PGYT 180:183) binding
- Y185 (= Y182) mutation to A: Nearly loss of activity.
- R195 (≠ P192) mutation to A: Nearly loss of activity.
3vzsB Crystal structure of phab from ralstonia eutropha in complex with acetoacetyl-coa and NADP (see paper)
45% identity, 97% coverage: 8:242/243 of query aligns to 11:248/249 of 3vzsB
- active site: N115 (= N109), S143 (= S137), Y156 (= Y150), K160 (= K154)
- binding acetoacetyl-coenzyme a: D97 (= D91), Q150 (= Q144), F151 (= F145), Q153 (= Q147), Y156 (= Y150), G187 (= G181), Y188 (= Y182), R198 (≠ P192)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), I18 (= I15), G38 (≠ T34), R43 (≠ Q39), G63 (≠ S60), N64 (= N61), V65 (= V62), G93 (= G87), I94 (= I88), T95 (= T89), P186 (= P180), I189 (≠ T183), M193 (= M187), V194 (≠ L188)
5vmlA Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b with bound NADP
43% identity, 97% coverage: 8:242/243 of query aligns to 7:244/245 of 5vmlA
- active site: G13 (= G14), N111 (= N109), S139 (= S137), Y152 (= Y150), K156 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), G12 (= G13), G13 (= G14), I14 (= I15), C33 (≠ T33), G34 (≠ T34), R39 (≠ Q39), G59 (≠ D63), N60 (= N64), V61 (≠ L65), N87 (= N85), G89 (= G87), I90 (= I88), S139 (= S137), Y152 (= Y150), K156 (= K154), P182 (= P180), G183 (= G181), I185 (≠ T183)
5vt6A Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with NADP
41% identity, 99% coverage: 4:243/243 of query aligns to 2:245/245 of 5vt6A
- active site: G12 (= G14), D102 (≠ Q101), S138 (= S137), Y151 (= Y150), K155 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), G11 (= G13), G12 (= G14), L13 (≠ I15), H32 (= H35), S33 (≠ R36), N36 (≠ Q39), V58 (≠ S60), D59 (≠ N61), V60 (= V62), N86 (= N85), A87 (≠ L86), G88 (= G87), I89 (= I88), I136 (= I135), Y151 (= Y150), K155 (= K154), P181 (= P180), Y183 (= Y182), L184 (≠ T183), T186 (= T185)
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
42% identity, 98% coverage: 4:242/243 of query aligns to 2:244/245 of 4k6fB
- active site: G12 (= G14), N102 (≠ Q101), S138 (= S137), Y151 (= Y150), K155 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), Y32 (≠ H35), S33 (≠ R36), N36 (≠ Q39), V58 (≠ S60), D59 (≠ N61), V60 (= V62), A87 (≠ L86), G88 (= G87), I89 (= I88)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
40% identity, 100% coverage: 1:242/243 of query aligns to 5:244/244 of 4nbuB
- active site: G18 (= G14), N111 (= N109), S139 (= S137), Q149 (= Q147), Y152 (= Y150), K156 (= K154)
- binding acetoacetyl-coenzyme a: D93 (= D91), K98 (= K96), S139 (= S137), N146 (≠ Q144), V147 (≠ F145), Q149 (= Q147), Y152 (= Y150), F184 (≠ Y182), M189 (= M187), K200 (≠ S198)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), N17 (≠ G13), G18 (= G14), I19 (= I15), D38 (≠ T34), F39 (≠ H35), V59 (≠ Y58), D60 (= D59), V61 (≠ S60), N87 (= N85), A88 (≠ L86), G89 (= G87), I90 (= I88), T137 (≠ I135), S139 (= S137), Y152 (= Y150), K156 (= K154), P182 (= P180), F184 (≠ Y182), T185 (= T183), T187 (= T185), M189 (= M187)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
39% identity, 99% coverage: 4:243/243 of query aligns to 6:244/244 of 6t62A
- active site: G16 (= G14), S138 (= S137), Y151 (= Y150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ T12), R15 (≠ G13), A36 (≠ T34), T37 (≠ A37), L58 (≠ Y58), D59 (= D59), V60 (vs. gap), N86 (= N85), A87 (≠ L86), G88 (= G87), I89 (= I88), I136 (= I135), S137 (= S136), S138 (= S137), Y151 (= Y150), K155 (= K154), P181 (= P180), G182 (= G181), I184 (≠ T183), M188 (= M187)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
39% identity, 99% coverage: 4:243/243 of query aligns to 6:244/244 of 6wprA
- active site: G16 (= G14), S138 (= S137), Y151 (= Y150)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ T12), R15 (≠ G13), T37 (≠ A37), L58 (≠ Y58), D59 (= D59), V60 (vs. gap), N86 (= N85), A87 (≠ L86), G88 (= G87), I89 (= I88), I136 (= I135), Y151 (= Y150), K155 (= K154), P181 (= P180)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
41% identity, 98% coverage: 4:242/243 of query aligns to 6:243/244 of 6t77A
- active site: G16 (= G14), S138 (= S137), Y151 (= Y150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ T12), R15 (≠ G13), T37 (= T34), L58 (≠ I56), N59 (≠ K57), V60 (≠ Y58), A87 (≠ L86), G88 (= G87), I89 (= I88)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
42% identity, 98% coverage: 4:242/243 of query aligns to 6:243/244 of P0AEK2
- GASR 12:15 (≠ GATG 10:13) binding
- T37 (= T34) binding
- NV 59:60 (≠ KY 57:58) binding
- N86 (= N85) binding
- Y151 (= Y150) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YCAAK 150:154) binding
- A154 (= A153) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K154) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ T183) binding
- E233 (≠ A232) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
42% identity, 98% coverage: 4:242/243 of query aligns to 5:242/243 of 1q7bA
- active site: G15 (= G14), E101 (≠ Q101), S137 (= S137), Q147 (= Q147), Y150 (= Y150), K154 (= K154)
- binding calcium ion: E232 (≠ A232), T233 (≠ D233)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), S13 (≠ T12), R14 (≠ G13), T36 (= T34), N58 (≠ K57), V59 (≠ Y58), N85 (= N85), A86 (≠ L86), G87 (= G87), I88 (= I88), S137 (= S137), Y150 (= Y150), K154 (= K154), P180 (= P180), G181 (= G181), I183 (≠ T183)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
42% identity, 98% coverage: 4:242/243 of query aligns to 5:242/243 of 7emgB
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
40% identity, 100% coverage: 1:243/243 of query aligns to 10:254/254 of 4ag3A
- active site: G23 (= G14), S148 (= S137), Y161 (= Y150), K165 (= K154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G10), S21 (≠ T12), R22 (≠ G13), G23 (= G14), I24 (= I15), T44 (≠ H35), L68 (≠ Y58), D69 (= D59), V70 (≠ S60), N96 (= N85), A97 (≠ L86), I146 (= I135), S148 (= S137), Y161 (= Y150), K165 (= K154), P191 (= P180), G192 (= G181), F193 (≠ Y182), I194 (≠ T183), T196 (= T185), M198 (= M187), T199 (≠ L188)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
41% identity, 98% coverage: 4:242/243 of query aligns to 5:242/243 of 1q7cA
- active site: G15 (= G14), S137 (= S137), Q147 (= Q147), F150 (≠ Y150), K154 (= K154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), S13 (≠ T12), R14 (≠ G13), A35 (vs. gap), T36 (= T34), L57 (≠ I56), N58 (≠ K57), V59 (≠ Y58), G87 (= G87), I88 (= I88)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 98% coverage: 4:242/243 of query aligns to 6:243/244 of P0A2C9
- M125 (= M124) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ L222) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (≠ D223) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
40% identity, 98% coverage: 4:242/243 of query aligns to 9:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G10), S17 (≠ T12), R18 (≠ G13), I20 (= I15), T40 (= T34), N62 (= N61), V63 (= V62), N89 (= N85), A90 (≠ L86), I92 (= I88), V139 (≠ I135), S141 (= S137), Y154 (= Y150), K158 (= K154), P184 (= P180), G185 (= G181), I187 (≠ T183), T189 (= T185), M191 (= M187)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
41% identity, 98% coverage: 4:242/243 of query aligns to 9:242/243 of 4i08A
- active site: G19 (= G14), N113 (= N109), S141 (= S137), Q151 (= Q147), Y154 (= Y150), K158 (= K154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G10), S17 (≠ T12), R18 (≠ G13), I20 (= I15), T40 (= T34), N62 (= N61), V63 (= V62), N89 (= N85), A90 (≠ L86), G140 (≠ S136), S141 (= S137), Y154 (= Y150), K158 (= K154), P184 (= P180), G185 (= G181), T189 (= T185)
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
40% identity, 100% coverage: 1:243/243 of query aligns to 16:255/255 of 4bo4C
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
38% identity, 100% coverage: 1:243/243 of query aligns to 5:241/241 of 4bnzA
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 99% coverage: 3:242/243 of query aligns to 4:246/246 of 3osuA
Query Sequence
>6938129 FitnessBrowser__SB2B:6938129
MNTKAVVVTGATGGIGWTIAEYLMSLEYFVIGTTHRAPQSACEQWIEMADKRGVLIKYDS
NVDNLSIDTLIEVANGHSIYGLVNNLGITRDSSFKKMTSEQWKQVMDVNLFSVFSLTQCI
FNHMALSGSGRIVNISSVNAHRGQFGQVNYCAAKAGLLGFTKALSLEGAKSGITVNSVSP
GYTDTKMLSHIPTDILQSIKDSVPMKRLAKPIEIAHAVAFLLDDKSAYITGADIPVNGGL
HLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory