Comparing 6938137 FitnessBrowser__SB2B:6938137 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3mqhA Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with coa and udp-3-amino-2-acetamido-2,3-dideoxy glucuronic acid (see paper)
76% identity, 96% coverage: 5:190/193 of query aligns to 5:190/191 of 3mqhA
3mqgC Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with acetyl-coa (see paper)
76% identity, 96% coverage: 5:190/193 of query aligns to 6:191/192 of 3mqgC
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
74% identity, 95% coverage: 1:183/193 of query aligns to 1:181/191 of G3XD01
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
45% identity, 77% coverage: 17:164/193 of query aligns to 13:153/294 of 4mzuF
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
46% identity, 73% coverage: 17:156/193 of query aligns to 13:144/290 of 4mzuB
Sites not aligning to the query:
7s45A Crystal structure of an n-acetyltransferase, c80t mutant, from helicobacter pullorum in the presence of acetyl coenzyme a and dtdp (see paper)
44% identity, 72% coverage: 3:140/193 of query aligns to 2:133/141 of 7s45A
7s42A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- galactose (see paper)
44% identity, 72% coverage: 3:140/193 of query aligns to 2:137/145 of 7s42A
7s41A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- glucose (see paper)
44% identity, 72% coverage: 3:140/193 of query aligns to 2:137/145 of 7s41A
7s3wA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d- galactose (see paper)
44% identity, 72% coverage: 3:140/193 of query aligns to 2:137/145 of 7s3wA
7s3uA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d-glucose (see paper)
44% identity, 72% coverage: 3:140/193 of query aligns to 2:137/145 of 7s3uA
3fscA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-fucose (see paper)
33% identity, 76% coverage: 17:163/193 of query aligns to 89:230/259 of 3fscA
Sites not aligning to the query:
3fs8A Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d- glucose n-acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with acetyl-coa (see paper)
33% identity, 76% coverage: 17:163/193 of query aligns to 89:230/259 of 3fs8A
Sites not aligning to the query:
3fsbA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-quinovose (see paper)
33% identity, 76% coverage: 17:163/193 of query aligns to 89:230/260 of 3fsbA
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
33% identity, 53% coverage: 48:150/193 of query aligns to 72:179/190 of 5u2kA
8e62C Structure of pcryo_0615 from psychrobacter cryohalolentis, an n- acetyltransferase required to produce diacetamido-2,3-dideoxy-d- glucuronic acid (see paper)
27% identity, 78% coverage: 4:153/193 of query aligns to 3:156/183 of 8e62C
Sites not aligning to the query:
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
30% identity, 58% coverage: 39:150/193 of query aligns to 66:176/183 of 3nz2C
Sites not aligning to the query:
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
30% identity, 58% coverage: 39:150/193 of query aligns to 59:169/176 of 3ectA
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
30% identity, 58% coverage: 39:150/193 of query aligns to 69:179/185 of 3nz2J
Sites not aligning to the query:
3d8vA Crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine (see paper)
30% identity, 78% coverage: 8:157/193 of query aligns to 328:462/478 of 3d8vA
Sites not aligning to the query:
3r8yA Structure of the bacillus anthracis tetrahydropicolinate succinyltransferase
30% identity, 79% coverage: 4:155/193 of query aligns to 77:203/203 of 3r8yA
>6938137 FitnessBrowser__SB2B:6938137
MDYQVHPSAIVDDGAQIGANTRVWHFVHVCGGAKIGSGCSLGQNVFVGNRVTIGNNVKVQ
NNVSIYDNVFVEDDVFCGPSMVFTNVYNPRSFIERKTEYRDTLVKRGATLGANCTIVCGV
TIGEYALVGAGAVINKDVKPFALVVGVPGKQIGWISKYGEQLTLPLQGDGEATCPHTGDI
YVLRDGLVELISK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory