Comparing 6938261 FitnessBrowser__SB2B:6938261 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
3cv1A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
70% identity, 95% coverage: 25:538/543 of query aligns to 17:528/529 of 3cv1A
3cuzA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
70% identity, 95% coverage: 25:538/543 of query aligns to 17:528/529 of 3cuzA
3cv2A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
70% identity, 95% coverage: 25:538/543 of query aligns to 12:523/524 of 3cv2A
3cuxA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
52% identity, 94% coverage: 27:538/543 of query aligns to 12:501/501 of 3cuxA
P30952 Malate synthase 1; EC 2.3.3.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
44% identity, 94% coverage: 27:536/543 of query aligns to 30:539/554 of P30952
Sites not aligning to the query:
>6938261 FitnessBrowser__SB2B:6938261
MTEQMMEQPQTLTGLKLAGHHIQGQEEVFTEGAMSLLESLCARFAGDVDALLAKRKERQV
RIDKGELPDFLPETRAIRDGKWTIRGIPTDLQDRRVEITGPVDRKMIINALNADVKVFMA
DFEDSLAPSWEKVIQGQINLRDAVRGTIEYKAPDTGKEYRLNDNPAVLIARVRGLHLKEK
HVEFNGQSIPGALFDFCFYFYHNYRQLLSKGSGPYFYIPKLESHLEARWWAKVFAFTEER
FCLEPGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKTLKHHSDRVL
PDRQQVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDAEANRLVLERVCKDKEL
EARNGHDGTWVAHPGLAQTAMAVFNQFIGDDHCNQLHITRDVDAPILASELLAPCEGERT
EHGMRLNIRIALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIHHQKHLSNGKLV
TKALLKEMLVEELANVKEEVGSERFTHGRFTQAAVLLEEITTADELVDFLTLPGYELLTK
QEH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory