SitesBLAST
Comparing 6938319 FitnessBrowser__SB2B:6938319 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A7B3 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Escherichia coli (strain K12) (see paper)
57% identity, 100% coverage: 1:292/292 of query aligns to 1:292/292 of P0A7B3
- R175 (= R174) mutation to E: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to G: Exhibits NADH kinase activity in addition to NAD kinase activity. Reduces the Vmax of the NAD kinase activity.; mutation to H: Exhibits NADH kinase activity in addition to NAD kinase activity.; mutation to I: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to K: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to Q: Exhibits NADH kinase activity in addition to NAD kinase activity.; mutation to T: Exhibits NADH kinase activity in addition to NAD kinase activity.
7mh7A Crystal structure of NAD kinase from pseudomonas aeruginosa pao1
51% identity, 98% coverage: 5:291/292 of query aligns to 3:290/290 of 7mh7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D71 (= D72), G72 (= G73), R93 (= R94), F98 (= F99), N145 (= N146), D146 (≠ E147), T186 (= T187), A187 (= A188), Y188 (= Y189), S191 (= S192), D244 (= D245), K283 (= K284)
P9WHV7 NAD kinase; ATP-dependent NAD kinase; Poly(P)-dependent NAD kinase; PPNK; EC 2.7.1.23 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
31% identity, 84% coverage: 47:290/292 of query aligns to 59:307/307 of P9WHV7
- D85 (= D72) mutation to A: Abolishes catalytic activity.
- N159 (= N146) mutation to A: Abolishes catalytic activity.
- NE 159:160 (= NE 146:147) binding
- E160 (= E147) mutation to A: Abolishes catalytic activity.
- G190 (= G177) mutation to A: Abolishes catalytic activity.
- L192 (≠ I179) mutation to A: Abolishes catalytic activity.
- T195 (= T182) mutation to A: It promotes stronger allosteric interactions.
- P196 (= P183) mutation to A: Abolishes catalytic activity.
- T197 (= T184) binding ; mutation to A: Abolishes catalytic activity.
- G198 (= G185) mutation to A: Abolishes catalytic activity.
- S199 (= S186) mutation to A: Lower catalytic efficiency. A perturbation of the allosteric interactions is observed when NAD is used as substrate.
- T200 (= T187) mutation to A: Abolishes catalytic activity.
- TAYAFS 200:205 (≠ TAYSLS 187:192) binding
- Y202 (= Y189) mutation to A: Abolishes catalytic activity.
- G207 (= G194) mutation to A: Abolishes catalytic activity.
- G208 (= G195) mutation to A: Possesses 30% of the activity compared to the wild-type enzyme. While mutant affects the catalytic efficiency, it does not alter the binding affinity for ATP and poly(P). It causes a decrease in the affinity for NAD and alters the allosteric interactions mediated by the dinucleotide, both in the presence of poly(P) and ATP.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
O13863 Uncharacterized kinase C1B1.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 79% coverage: 61:290/292 of query aligns to 277:514/537 of O13863
Sites not aligning to the query:
- 72 modified: Phosphoserine
3afoA Crystal structure of yeast nadh kinase complexed with nadh
32% identity, 69% coverage: 59:260/292 of query aligns to 107:315/360 of 3afoA
- binding 1,4-dihydronicotinamide adenine dinucleotide: D120 (= D72), G121 (= G73), L124 (= L76), F148 (= F99), N196 (= N146), D197 (≠ E147), T237 (= T187), A238 (= A188), Y239 (= Y189), S242 (= S192), D300 (= D245), G301 (= G246)
1y3iA Crystal structure of mycobacterium tuberculosis NAD kinase-NAD complex (see paper)
34% identity, 65% coverage: 70:258/292 of query aligns to 12:199/231 of 1y3iA
- binding nicotinamide-adenine-dinucleotide: D14 (= D72), G15 (= G73), R38 (≠ N96), F41 (= F99), L42 (= L100), N88 (= N146), E89 (= E147), T129 (= T187), A130 (= A188), Y131 (= Y189), S134 (= S192)
Q9P7K3 Uncharacterized kinase C24B10.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 77% coverage: 64:288/292 of query aligns to 176:407/449 of Q9P7K3
Sites not aligning to the query:
- 420 modified: Phosphoserine
1z0zA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with NAD (see paper)
31% identity, 64% coverage: 64:250/292 of query aligns to 41:222/249 of 1z0zA
- active site: E96 (= E131), C105 (≠ A140)
- binding nicotinamide-adenine-dinucleotide: N115 (= N146), E116 (= E147), M127 (= M158), R143 (= R174), D145 (= D176), T156 (= T187), Y158 (= Y189), S161 (= S192), F182 (≠ H213), D209 (≠ N236), G210 (= G237)
1z0sA Crystal structure of an NAD kinase from archaeoglobus fulgidus in complex with atp (see paper)
31% identity, 64% coverage: 64:250/292 of query aligns to 41:222/249 of 1z0sA
- active site: E96 (= E131), C105 (≠ A140)
- binding adenosine-5'-triphosphate: R54 (≠ G77), N115 (= N146), E116 (= E147), A125 (= A156), K126 (≠ H157), M127 (= M158), D145 (= D176), G157 (≠ A188), Y158 (= Y189), S161 (= S192), A180 (≠ F211), F182 (≠ H213), D209 (≠ N236)
- binding pyrophosphate 2-: G48 (= G71), G50 (= G73), T51 (≠ N74), R54 (≠ G77), R72 (≠ N96)
Sites not aligning to the query:
1suwA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with its substrate and product: insights into the catalysis of NAD kinase (see paper)
31% identity, 64% coverage: 64:250/292 of query aligns to 41:222/249 of 1suwA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G48 (= G71), D49 (= D72), G50 (= G73), N115 (= N146), E116 (= E147), A125 (= A156), M127 (= M158), R143 (= R174), D145 (= D176), T156 (= T187), Y158 (= Y189), S161 (= S192), F182 (≠ H213), D209 (≠ N236), G210 (= G237)
O30297 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
31% identity, 64% coverage: 64:250/292 of query aligns to 41:222/249 of O30297
6rbzA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
26% identity, 74% coverage: 64:278/292 of query aligns to 37:252/262 of 6rbzA
7zzdA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
26% identity, 74% coverage: 64:278/292 of query aligns to 37:252/262 of 7zzdA
- binding 2-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-[3-[6-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-[(3-azanylpropanoylamino)methyl]-3,4-bis(oxidanyl)oxolan-2-yl]purin-8-yl]prop-2-ynyl]amino]ethanoic acid: D45 (= D72), G46 (= G73), F74 (= F99), Y75 (≠ L100), N120 (= N146), E121 (= E147), T159 (= T187), A160 (= A188), Y161 (= Y189), S164 (= S192), H221 (= H247)
7zz9A Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
26% identity, 74% coverage: 64:278/292 of query aligns to 37:252/262 of 7zz9A
- binding 3-[[(2~{R},3~{S},4~{R},5~{R})-5-[8-[3-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-(2-azanylethyl)amino]prop-1-ynyl]-6-azanyl-purin-9-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methylamino]-3-oxidanylidene-propanoic acid: D45 (= D72), G46 (= G73), L49 (= L76), F74 (= F99), Y75 (≠ L100), N120 (= N146), E121 (= E147), T159 (= T187), A160 (= A188), Y161 (= Y189), S164 (= S192)
6z64A Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a di-adenosine derivative (see paper)
26% identity, 74% coverage: 64:278/292 of query aligns to 37:252/262 of 6z64A
- binding (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[[3-[6-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl]purin-8-yl]prop-2-ynyl-(3-azanylpropyl)amino]methyl]oxolane-3,4-diol: D45 (= D72), L49 (= L76), F74 (= F99), Y75 (≠ L100), N120 (= N146), E121 (= E147), T159 (= T187), A160 (= A188), Y161 (= Y189), S164 (= S192)
5dhuA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
26% identity, 74% coverage: 64:278/292 of query aligns to 37:253/263 of 5dhuA
5dhtA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
26% identity, 74% coverage: 64:278/292 of query aligns to 37:253/263 of 5dhtA
5dhsA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
26% identity, 74% coverage: 64:278/292 of query aligns to 37:253/263 of 5dhsA
- binding 5'-azido-5'-deoxy-8-[(2-{[2-(3-ethynylphenyl)ethyl]amino}-2-oxoethyl)sulfanyl]adenosine: N121 (= N146), E122 (= E147), G130 (≠ I155), P131 (≠ A156), R147 (= R174), G148 (≠ A175), D149 (= D176), Y162 (= Y189), S165 (= S192), A184 (≠ F211), H222 (= H247)
5dhrA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
26% identity, 74% coverage: 64:278/292 of query aligns to 37:253/263 of 5dhrA
5dhqA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
26% identity, 74% coverage: 64:278/292 of query aligns to 37:253/263 of 5dhqA
Query Sequence
>6938319 FitnessBrowser__SB2B:6938319
MTSQFHTIGLIGKPHHNGTNLTLKRLHHWLGSQGYEVLVEERVAGELGAKVEAVDLLAIG
NRCDLAIVVGGDGNMLGAARVLARFDVGVIGVNRGNLGFLTDLPPDGFEESLAAVLDGEF
ITEHRFLLEAEVHRHGTMKASNTAVNEAVLHPGKIAHMIEYEVYIDNQFMYSQRADGMIV
STPTGSTAYSLSAGGAILTPNLQALILVPMFPHTLSCRPIVVDANSTIKLVVSPENGENL
EVSCDGHVTLAVLPGDEIFIRQSSERLRLIHPKNYNYFHVLRNKLGWGSKLF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory