SitesBLAST
Comparing 6938339 FitnessBrowser__SB2B:6938339 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
26% identity, 54% coverage: 17:255/442 of query aligns to 12:229/824 of Q8GAI3
- W66 (≠ A79) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ R80) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
22% identity, 83% coverage: 40:408/442 of query aligns to 3:352/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I44), G8 (= G45), G10 (= G47), V11 (≠ F48), I12 (≠ T49), V30 (≠ L68), E31 (= E69), K32 (≠ A70), E38 (≠ G76), A39 (= A77), S40 (= S78), A43 (≠ N81), G45 (= G83), L46 (≠ F84), V171 (= V222), G200 (= G250), G201 (≠ N251), W203 (≠ Y253), G298 (= G357), R300 (≠ L359), P301 (≠ A360), Y326 (≠ C382), R327 (≠ G383), N328 (≠ A384), G329 (= G385), I330 (≠ V386)
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
22% identity, 66% coverage: 25:316/442 of query aligns to 36:310/866 of Q9UI17
- CV 59:60 (≠ FT 48:49) binding
- EK 80:81 (≠ EA 69:70) binding
- 87:95 (vs. 76:84, 22% identical) binding
- H91 (≠ R80) modified: Tele-8alpha-FAD histidine
- H109 (≠ D102) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V222) binding
- S279 (≠ A285) to P: in dbSNP:rs532964
Sites not aligning to the query:
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
19% identity, 42% coverage: 185:369/442 of query aligns to 137:312/369 of O31616
- V174 (= V222) binding
- H244 (≠ Y304) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ L359) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- 327:333 binding
- 329 binding
Query Sequence
>6938339 FitnessBrowser__SB2B:6938339
MYDPLISTNAAQQALPSTFWSGTTEPLPESPRLQGHLQTDVIVIGGGFTGLLTAYYLATE
YGRQVTLLEANRIGFGASARNGGFVLKGSGRLGYGQMAKRWDLDTAKGIYQEFSEAVARV
EGLIQDGKIDCNPQEKGYLKIAHSPKAMKTLQAGADFIARHMGQGAEFICPARLRIDYLN
HHQSYGALRLADGFGLNPLKLLQGYARLAREAGVQIFEQSTVLASVRTAKGFSLETEAGR
IDANAMVFAGNAYTQPGLTETLTGRFLPILSNVIVTEPLSEAVLAEAGLYSRQVAMDTRI
LKYYYRLLPENRLLFGGRGAVWGRDADNSVYPARLKEAMNKAFPALTDVGLSHTWHGWLA
ASLDDMPHVYTRGGEGYSLGYCGAGVSFSSQAAWRLAGMLSGKAAPSLPLYGTPLPAFPL
APLRRVGQWAFYHYGRFIDAWS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory