Comparing 6938423 FitnessBrowser__SB2B:6938423 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
48% identity, 89% coverage: 35:358/363 of query aligns to 1:324/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
47% identity, 89% coverage: 35:358/363 of query aligns to 2:325/329 of 4petA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
44% identity, 88% coverage: 36:355/363 of query aligns to 4:322/330 of 7ug8B
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
40% identity, 90% coverage: 34:358/363 of query aligns to 1:324/337 of 2hzlB
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
40% identity, 89% coverage: 36:358/363 of query aligns to 31:352/365 of Q3J1R2
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
38% identity, 88% coverage: 37:357/363 of query aligns to 5:324/344 of 4yicA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
30% identity, 65% coverage: 31:267/363 of query aligns to 28:269/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
26% identity, 86% coverage: 35:347/363 of query aligns to 1:317/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
26% identity, 86% coverage: 35:347/363 of query aligns to 1:317/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
27% identity, 79% coverage: 59:343/363 of query aligns to 22:306/315 of 4pe3A
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
25% identity, 86% coverage: 37:349/363 of query aligns to 3:309/317 of 4xf5A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
25% identity, 86% coverage: 37:349/363 of query aligns to 2:308/315 of 4uabA
7e9yA Crystal structure of elacco1 (see paper)
27% identity, 50% coverage: 35:216/363 of query aligns to 1:182/563 of 7e9yA
Sites not aligning to the query:
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
25% identity, 75% coverage: 53:323/363 of query aligns to 20:287/310 of 7bcrA
Sites not aligning to the query:
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
25% identity, 75% coverage: 53:323/363 of query aligns to 20:287/310 of 7bcpA
Sites not aligning to the query:
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
25% identity, 75% coverage: 53:323/363 of query aligns to 20:287/310 of 7bcoA
Sites not aligning to the query:
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
25% identity, 75% coverage: 53:323/363 of query aligns to 20:287/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
25% identity, 75% coverage: 53:323/363 of query aligns to 21:288/310 of 7bbrA
Sites not aligning to the query:
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
27% identity, 67% coverage: 38:281/363 of query aligns to 4:248/314 of 4p8bA
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
26% identity, 63% coverage: 55:284/363 of query aligns to 19:251/305 of 4mnpA
>6938423 FitnessBrowser__SB2B:6938423
MQTRLRICMLMAASLLAGCNDDKQAAEATPIDSAKQIEWKLATSWPKNFPGLGTAPEHFA
VMVDEMSAGRLKIKVYGAGELMPALEVFDAVSQGSVQMAHSASYYWKGKAPAAQFFTSIP
FGLNAQEMNGWLTYGGGQELWEEVYAPFGILPLPGGNSGVQMGGWFNKEINTIDDLKGLK
MRLPGLGGEVLKRLEGVPVTLPGRELYTAMQTGAIDATEWVGPYNDLAFGLHKVAKYYYY
PGWHEPGTTLEFMINKAAFEKLPKDLQAIVKIAAKATNQDMLDEYTARNVGALDALVNEH
GVVLKQFPEEVMAQLRSVSAEVISEQSSQDPMMKKVNEAYREYEAGVRKYHLISEDAYTR
LRE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory