SitesBLAST
Comparing 6938507 FitnessBrowser__SB2B:6938507 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9FLY0 Protein SAR DEFICIENT 4; Ornithine cyclodeaminase-like protein; AtOCD from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 95% coverage: 13:312/317 of query aligns to 17:319/325 of Q9FLY0
- G89 (≠ S81) mutation to E: In sard4-3; compromises systemic acquired resistance (SAR).
- G138 (≠ A133) mutation to D: In sard4-4; compromises systemic acquired resistance (SAR).
- S205 (= S197) mutation to N: In sard4-1; compromises systemic acquired resistance (SAR).
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
30% identity, 100% coverage: 1:317/317 of query aligns to 1:317/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (= S81), T111 (= T110), G136 (= G135), V137 (≠ N136), Q138 (≠ L137), D159 (≠ G158), I160 (≠ R159), A199 (= A199), T200 (= T200), T201 (≠ G201), A202 (≠ S202), V206 (≠ L206), V221 (= V221), G222 (= G222), W223 (≠ N223), S296 (= S296), V297 (= V297), G298 (= G298)
- binding proline: R39 (= R35), M54 (≠ L53), K67 (= K64), R110 (= R109)
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
30% identity, 94% coverage: 13:311/317 of query aligns to 21:306/312 of 2i99A
- active site: G59 (≠ A51), S228 (≠ H224)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D81 (= D71), S90 (= S81), H91 (≠ L82), R118 (= R109), T119 (= T110), G142 (= G135), A143 (= A138), G144 (≠ V139), V145 (≠ Y140), Q146 (≠ M141), N167 (≠ G158), R168 (= R159), T169 (≠ N160), V203 (≠ A199), T204 (= T200), L205 (≠ G201), A206 (≠ S202), V225 (= V221), G226 (= G222), S291 (= S296), L292 (≠ V297), G293 (= G298)
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
30% identity, 94% coverage: 13:311/317 of query aligns to 22:307/314 of Q14894
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
29% identity, 94% coverage: 13:311/317 of query aligns to 21:297/303 of 4bvaA
- active site: G59 (≠ A51), S219 (≠ H224)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T106), R109 (= R109), T110 (= T110), G135 (= G135), V136 (≠ N136), Q137 (≠ L137), N158 (≠ G158), R159 (= R159), T160 (≠ N160), N163 (≠ K163), V194 (≠ A199), T195 (= T200), M196 (≠ G201), A197 (≠ S202), V216 (= V221), S282 (= S296), L283 (≠ V297), G284 (= G298)
- binding 3,5,3'triiodothyronine: R46 (≠ Y38), F57 (≠ A49), G59 (≠ A51), V76 (≠ F66), F78 (≠ Y68), S219 (≠ H224), R220 (≠ H225), W223 (≠ C228), E247 (= E252)
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
29% identity, 94% coverage: 13:311/317 of query aligns to 20:298/303 of 4bv9A
- active site: G58 (≠ A51), S220 (≠ H224)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S82 (= S81), H83 (≠ L82), T111 (= T110), G134 (≠ A133), G136 (= G135), V137 (≠ N136), Q138 (≠ L137), N159 (≠ G158), R160 (= R159), T161 (≠ N160), V195 (≠ A199), T196 (= T200), M197 (≠ G201), A198 (≠ S202), V217 (= V221), G218 (= G222), S283 (= S296), L284 (≠ V297), G285 (= G298)
- binding pyruvic acid: R45 (≠ Y38), M60 (≠ L53), K73 (= K64), R110 (= R109)
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
28% identity, 77% coverage: 70:312/317 of query aligns to 71:306/322 of O28608
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
28% identity, 77% coverage: 70:312/317 of query aligns to 71:306/320 of 1omoA
- active site: D219 (≠ H224)
- binding nicotinamide-adenine-dinucleotide: T109 (= T110), G134 (= G135), T135 (≠ N136), Q136 (≠ L137), Y156 (≠ W157), D157 (≠ G158), V158 (≠ R159), R159 (≠ N160), T195 (= T200), P196 (≠ G201), G217 (= G222), D219 (≠ H224), K223 (≠ C228), S290 (= S296), T291 (≠ V297), G292 (= G298)
Sites not aligning to the query:
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
28% identity, 81% coverage: 61:317/317 of query aligns to 66:314/322 of 6rqaB
- binding Tb-Xo4: N76 (≠ D71)
- binding nicotinamide-adenine-dinucleotide: T113 (= T110), G138 (= G135), Q140 (≠ L137), P162 (≠ R159), H163 (≠ N160), I199 (≠ A199), T200 (= T200), S201 (≠ G201), S202 (= S202), M221 (≠ V221), G222 (= G222), D224 (≠ H224), K228 (≠ C228), G293 (≠ S296), T294 (≠ V297), G295 (= G298)
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
28% identity, 81% coverage: 61:317/317 of query aligns to 66:314/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (≠ L82), T113 (= T110), G138 (= G135), H139 (≠ N136), Q140 (≠ L137), N161 (≠ G158), P162 (≠ R159), H163 (≠ N160), M166 (≠ K163), I199 (≠ A199), T200 (= T200), S201 (≠ G201), S202 (= S202), M221 (≠ V221), G222 (= G222), D224 (≠ H224), K228 (≠ C228), G293 (≠ S296)
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
28% identity, 81% coverage: 61:317/317 of query aligns to 64:312/320 of A1B8Z0
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
25% identity, 84% coverage: 52:317/317 of query aligns to 57:314/350 of Q88H32
Sites not aligning to the query:
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
25% identity, 84% coverage: 52:317/317 of query aligns to 56:313/340 of 1x7dA
- active site: D227 (≠ H224)
- binding nicotinamide-adenine-dinucleotide: T83 (≠ S81), R111 (= R109), T112 (= T110), G137 (= G135), A138 (≠ N136), Q139 (≠ L137), D160 (≠ G158), T161 (≠ R159), V200 (≠ A199), T201 (= T200), A202 (≠ G201), I209 (≠ L206), V224 (= V221), G225 (= G222), D227 (≠ H224), K231 (≠ C228), S292 (= S296), V293 (= V297), G294 (= G298)
- binding L-ornithine: M57 (≠ L53), K68 (= K64), V70 (≠ F66), N71 (≠ T67), G72 (≠ Y68), R111 (= R109), D227 (≠ H224), V293 (= V297)
Sites not aligning to the query:
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
25% identity, 78% coverage: 71:317/317 of query aligns to 83:325/334 of 4mp6A
- active site: M236 (≠ C231)
- binding nicotinamide-adenine-dinucleotide: R92 (≠ S81), R120 (= R109), T121 (= T110), G146 (= G135), L147 (≠ N136), I148 (≠ L137), D170 (≠ G158), Q171 (≠ R159), C211 (≠ A199), T212 (= T200), V213 (≠ G201), I233 (≠ C228), G306 (= G298)
Sites not aligning to the query:
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
25% identity, 84% coverage: 52:317/317 of query aligns to 56:313/341 of 1u7hA
- active site: D227 (≠ H224)
- binding nicotinamide-adenine-dinucleotide: T83 (≠ S81), R111 (= R109), T112 (= T110), G137 (= G135), A138 (≠ N136), Q139 (≠ L137), D160 (≠ G158), T161 (≠ R159), V200 (≠ A199), T201 (= T200), A202 (≠ G201), I209 (≠ L206), V224 (= V221), G225 (= G222), D227 (≠ H224), K231 (≠ C228), S292 (= S296), V293 (= V297), G294 (= G298)
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
29% identity, 77% coverage: 59:303/317 of query aligns to 76:312/357 of 5gzlA
- binding lysine: D240 (≠ H224), R267 (≠ S251), E268 (= E252)
- binding nicotinamide-adenine-dinucleotide: Y85 (= Y68), T97 (≠ S81), I98 (≠ L82), T126 (= T110), G151 (= G135), A152 (≠ N136), Q153 (≠ L137), D174 (≠ N160), T175 (= T161), H179 (≠ D165), A212 (= A199), T213 (= T200), S214 (≠ G201), V222 (≠ L206), V237 (= V221), G238 (= G222), A239 (≠ N223), D240 (≠ H224), K244 (≠ C228), S305 (= S296), T306 (≠ V297), G307 (= G298)
Sites not aligning to the query:
5gziA Cyclodeaminase_pa
29% identity, 77% coverage: 59:303/317 of query aligns to 76:312/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (= Y68), T97 (≠ S81), R125 (= R109), T126 (= T110), G151 (= G135), A152 (≠ N136), Q153 (≠ L137), D174 (≠ N160), T175 (= T161), H179 (≠ D165), A212 (= A199), T213 (= T200), S214 (≠ G201), V215 (vs. gap), V237 (= V221), G238 (= G222), A239 (≠ N223), S305 (= S296), T306 (≠ V297), G307 (= G298)
- binding (2S)-piperidine-2-carboxylic acid: K81 (= K64), R125 (= R109), A239 (≠ N223), T306 (≠ V297), G307 (= G298)
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
29% identity, 77% coverage: 59:303/317 of query aligns to 72:308/344 of 5yu4A
- binding 2,4-diaminobutyric acid: K77 (= K64), R121 (= R109), T302 (≠ V297), G303 (= G298)
- binding nicotinamide-adenine-dinucleotide: Y81 (= Y68), T93 (≠ S81), I94 (≠ L82), R121 (= R109), T122 (= T110), G147 (= G135), A148 (≠ N136), Q149 (≠ L137), D170 (≠ N160), T171 (= T161), H175 (≠ D165), A208 (= A199), T209 (= T200), S210 (≠ G201), V211 (vs. gap), V218 (≠ L206), V233 (= V221), A235 (≠ N223), S301 (= S296), T302 (≠ V297), G303 (= G298)
Sites not aligning to the query:
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
29% identity, 77% coverage: 59:303/317 of query aligns to 72:308/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (= Y68), T93 (≠ S81), I94 (≠ L82), T122 (= T110), G147 (= G135), A148 (≠ N136), Q149 (≠ L137), D170 (≠ N160), T171 (= T161), A208 (= A199), T209 (= T200), S210 (≠ G201), V211 (vs. gap), V233 (= V221), A235 (≠ N223), S301 (= S296), T302 (≠ V297), G303 (= G298)
- binding proline: K77 (= K64), R121 (= R109)
Sites not aligning to the query:
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
25% identity, 78% coverage: 71:317/317 of query aligns to 71:309/318 of 4mpdA
- active site: M224 (vs. gap)
- binding 2-oxoglutaric acid: R80 (≠ S81), M289 (≠ V297)
- binding nicotinamide-adenine-dinucleotide (acidic form): R80 (≠ S81), R108 (= R109), T109 (= T110), G134 (= G135), I136 (≠ L137), D158 (≠ G158), Q159 (≠ R159), F160 (≠ N160), T200 (= T200), V201 (≠ G201), I221 (vs. gap)
Sites not aligning to the query:
Query Sequence
>6938507 FitnessBrowser__SB2B:6938507
MKIIDGNQVQQKLTFPPLVEALRQQLCRPFTMPQRQVYALSDTADNQHAFALLPAWDEES
IAVKAFTYLPDNPVKNPGCESLYSQILLFDRKTGVPQALIDGTSVTYWRTAATSALAASF
LARKDSSRLLMCATGNLAVYMALAHASVRPIREIRIWGRNTQKIDSTIATIRAQRTDIEV
TAANALQLDVPWADIISCATGSPTPLFPGEWVTPGTHTDFVGNHHKDCRECDSHLITNSQ
VYVDARLNVFSEAGELLIPVSEGRFSLDEVRAELSELCQGTALGRVNDKDITMFKSVGSA
LADLAGARLLFKMLQEQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory