Comparing 6938539 FitnessBrowser__SB2B:6938539 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
Q9I6J1 Putrescine-binding periplasmic protein SpuD from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
61% identity, 100% coverage: 1:366/366 of query aligns to 2:367/367 of Q9I6J1
Q9I6J0 Spermidine-binding periplasmic protein SpuE from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
63% identity, 98% coverage: 7:366/366 of query aligns to 11:365/365 of Q9I6J0
3ttnA Crystal structures of polyamine receptors spud and spue from pseudomonas aeruginosa (see paper)
65% identity, 92% coverage: 29:363/366 of query aligns to 2:335/335 of 3ttnA
3ttmA Crystal structure of spud in complex with putrescine (see paper)
63% identity, 93% coverage: 27:365/366 of query aligns to 3:341/341 of 3ttmA
P31133 Putrescine-binding periplasmic protein PotF from Escherichia coli (strain K12) (see 3 papers)
56% identity, 98% coverage: 9:366/366 of query aligns to 16:370/370 of P31133
Sites not aligning to the query:
7oywA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l s247d in complex with spermidine (see paper)
57% identity, 93% coverage: 26:366/366 of query aligns to 1:342/348 of 7oywA
7oyxB E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y s247d in complex with spermidine (see paper)
57% identity, 93% coverage: 26:366/366 of query aligns to 1:342/347 of 7oyxB
7oyvA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88a s247d in complex with spermidine (see paper)
57% identity, 93% coverage: 26:365/366 of query aligns to 1:341/341 of 7oyvA
6ye7A E.Coli's putrescine receptor potf complexed with cadaverine (see paper)
58% identity, 93% coverage: 26:365/366 of query aligns to 1:341/341 of 6ye7A
6ye6A E.Coli's putrescine receptor potf complexed with agmatine (see paper)
58% identity, 93% coverage: 26:365/366 of query aligns to 1:341/341 of 6ye6A
6ye0B E.Coli's putrescine receptor potf complexed with putrescine (see paper)
58% identity, 93% coverage: 26:365/366 of query aligns to 1:341/341 of 6ye0B
1a99A Putrescine receptor (potf) from e. Coli (see paper)
58% identity, 93% coverage: 26:365/366 of query aligns to 1:341/341 of 1a99A
P0AFK9 Spermidine/putrescine-binding periplasmic protein; SPBP from Escherichia coli (strain K12) (see 3 papers)
34% identity, 92% coverage: 1:338/366 of query aligns to 1:321/348 of P0AFK9
Sites not aligning to the query:
1poy1 Spermidine/putrescine-binding protein complexed with spermidine (dimer form) (see paper)
36% identity, 85% coverage: 28:338/366 of query aligns to 3:296/323 of 1poy1
Sites not aligning to the query:
7xjnA Structure of vcpotd1 in complex with norspermidine
33% identity, 86% coverage: 26:338/366 of query aligns to 2:296/322 of 7xjnA
Sites not aligning to the query:
4eqbA 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes
33% identity, 85% coverage: 31:341/366 of query aligns to 6:297/323 of 4eqbA
Sites not aligning to the query:
>6938539 FitnessBrowser__SB2B:6938539
MKLLHKMTALALVTAGVLGSAAVSAEEVVRVYNWSDYIAEDTLENFQKETGIRVIYDVFD
TNEVLEAKLLSGRSGYDLVVPSAHFLAKQIKAGAFMKLDKSKLTNEKHLNKNLMTQLQKS
DPGNEHAVPYLWGTTGIGFNVAKVKEVLGEDAPVDSWDLIFNPANAEKLAKCGIAVLDSP
DEILPPALNYLGLNPNSTDPADYEKAGEVLLKIRPYLKYFHSSRYISDLANGEICAAIGW
SGDVLQAQARAEEAGNGQQVDYRIPKEGAPLWFDMMAIPADAANADNALTFMNYLMRPEV
IASISNYVAYANANDGSNPLLDEEVAKNPAVYPSEETLAKLYLGEVRPMKTQRAMTRIWT
KIKSGQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory