Comparing 6938540 FitnessBrowser__SB2B:6938540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
64% identity, 98% coverage: 4:455/460 of query aligns to 2:449/450 of 6gwiB
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
62% identity, 96% coverage: 13:455/460 of query aligns to 6:442/443 of 7qx0B
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
63% identity, 92% coverage: 35:455/460 of query aligns to 1:421/422 of 7qx3A
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
55% identity, 98% coverage: 8:459/460 of query aligns to 1:452/453 of 6s4gA
7q9xAAA Probable aminotransferase
55% identity, 98% coverage: 8:459/460 of query aligns to 2:453/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
55% identity, 98% coverage: 8:459/460 of query aligns to 2:453/455 of 4a6tC
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
61% identity, 90% coverage: 36:451/460 of query aligns to 1:379/384 of 5ti8B
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
56% identity, 94% coverage: 9:441/460 of query aligns to 3:437/454 of 7ypmA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
55% identity, 94% coverage: 9:441/460 of query aligns to 3:437/455 of 7ypnD
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
55% identity, 92% coverage: 36:459/460 of query aligns to 2:425/427 of 4ba5A
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
55% identity, 92% coverage: 36:459/460 of query aligns to 1:421/423 of 4a6rA
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
45% identity, 97% coverage: 10:453/460 of query aligns to 6:448/448 of 6io1B
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
45% identity, 97% coverage: 12:455/460 of query aligns to 9:460/460 of 5kr6B
5ghgB Transaminase w58l with smba
43% identity, 97% coverage: 10:457/460 of query aligns to 2:429/433 of 5ghgB
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
45% identity, 94% coverage: 16:448/460 of query aligns to 11:451/459 of 5kquC
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
44% identity, 96% coverage: 8:448/460 of query aligns to 1:449/455 of 5kr5A
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
42% identity, 98% coverage: 10:459/460 of query aligns to 1:453/453 of 6g4dB
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
42% identity, 97% coverage: 10:453/460 of query aligns to 1:447/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
42% identity, 97% coverage: 10:453/460 of query aligns to 1:447/451 of 6g4eA
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
43% identity, 97% coverage: 8:455/460 of query aligns to 4:457/458 of 5kr3A
>6938540 FitnessBrowser__SB2B:6938540
MQQQQQDTISALQAMDAAHHLHPFTDSADLAKRGTRVIERAEGVYIWDAKGNKLLDAMAG
LWCVNVGYGRKSIADAAYAQLQTLPFYNNFFQCTHEPAIRLASKIASLAPGHMNRVFFTG
SGSEANDTNLRMVRRYWDLKGMPSKKTIISRKNAYHGSTVAGASLGGMGFMHQQGDLPIP
GIVHIDQPYWFGEGRDMSPEAFGIKTAQALEAKILELGEDKVAAFIAEPFQGAGGVIIPP
DSYWNEIKRILEKYNILFILDEVISGFGRTGNWFAAQTLGLKPDLITIAKGMTSGYIPMG
GVIVSDRVADVLISDGGEFAHGFTYSGHPVAAAVALENIRILEEERLVDKVRTDTGPYLQ
DRLQTLSAHPLVGEVRGMGMVGAIELVADKHSMVRFGSEISAGMLCREACIESGLVMRAV
GDTMIISPPLCITRDEIDELIFKASQALSLTLEKIAARGN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory