SitesBLAST
Comparing 6938665 FitnessBrowser__SB2B:6938665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
48% identity, 93% coverage: 9:409/430 of query aligns to 3:420/425 of O59010
- S65 (= S65) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S270) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 270:272) binding
- M311 (= M306) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T309) binding
- V355 (= V350) binding
- D394 (= D383) binding
- M395 (= M384) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R386) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N390) binding
- D405 (= D394) mutation to N: Strongly decreased affinity for aspartate.
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
49% identity, 93% coverage: 9:409/430 of query aligns to 1:420/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
49% identity, 93% coverage: 9:409/430 of query aligns to 1:420/427 of 5e9sA
- binding aspartic acid: R274 (≠ S270), S275 (= S271), S276 (= S272), T313 (= T309), G353 (= G349), V354 (= V350), A357 (= A353), G358 (= G354), D394 (= D383), R397 (= R386), T398 (= T387)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K189), G198 (≠ M193), Y202 (≠ L197)
- binding sodium ion: Y87 (= Y90), T90 (= T93), S91 (≠ T94), S276 (= S272), G305 (= G301), A306 (≠ T302), T307 (= T303), N309 (= N305), N309 (= N305), M310 (= M306), D311 (= D307), S348 (= S344), I349 (= I345), G350 (= G346), T351 (= T347), N401 (= N390), V402 (= V391), D405 (= D394)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
49% identity, 93% coverage: 11:409/430 of query aligns to 1:418/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
48% identity, 93% coverage: 12:409/430 of query aligns to 1:417/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L3 (≠ C14), L191 (≠ K189), G195 (≠ M193), R282 (≠ K281)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S270), S272 (= S271), S273 (= S272), M307 (= M306), T310 (= T309), G353 (= G352), A354 (= A353), R394 (= R386), T395 (= T387)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
47% identity, 93% coverage: 9:408/430 of query aligns to 3:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ W10), Y7 (≠ W13), F46 (≠ I46), F46 (≠ I46), P75 (≠ D75), L91 (≠ A92), F95 (≠ I96), L130 (≠ V131), I133 (≠ T134), I159 (≠ V160), Y167 (≠ L168), K196 (= K189), G200 (≠ M193), I207 (≠ Y200), F210 (= F203), L250 (≠ V243), I262 (≠ F256), M269 (= M263), T334 (= T329), V335 (≠ W330), G336 (≠ V331), T340 (= T335), L343 (= L338), M399 (≠ V388)
- binding aspartic acid: S277 (= S271), S278 (= S272), T314 (= T309), G354 (= G349), A358 (= A353), G359 (= G354), D394 (= D383), R397 (= R386), T398 (= T387)
- binding sodium ion: Y89 (= Y90), T92 (= T93), S93 (≠ T94), G306 (= G301), T308 (= T303), N310 (= N305), N310 (= N305), M311 (= M306), D312 (= D307), S349 (= S344), I350 (= I345), T352 (= T347), N401 (= N390), V402 (= V391), D405 (= D394)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
47% identity, 92% coverage: 10:405/430 of query aligns to 1:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ W13), G66 (= G69), V83 (≠ F87), I157 (≠ A161), Y164 (≠ L168), K193 (= K189), T305 (= T303), I306 (= I304), I347 (= I345)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I22), M199 (= M195), S275 (= S272), T311 (= T309), G356 (= G354), L384 (≠ A376), D391 (= D383), R394 (= R386)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
49% identity, 91% coverage: 17:409/430 of query aligns to 2:409/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S270), S265 (= S272), M299 (= M306), T302 (= T309), T340 (= T347), G342 (= G349), V343 (= V350), G347 (= G354), D383 (= D383), R386 (= R386), T387 (= T387), N390 (= N390)
- binding decyl-beta-d-maltopyranoside: H23 (≠ P38), V212 (≠ L218), A216 (≠ I222)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
48% identity, 91% coverage: 17:406/430 of query aligns to 3:409/409 of 6bavA
2nwwA Crystal structure of gltph in complex with tboa (see paper)
48% identity, 90% coverage: 17:405/430 of query aligns to 2:407/407 of 2nwwA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
48% identity, 90% coverage: 17:405/430 of query aligns to 3:408/408 of 6bauA
- binding cysteine: S270 (= S272), M303 (= M306), T306 (= T309), A345 (= A348), G346 (= G349), V347 (= V350), G351 (= G354), D386 (= D383), C389 (≠ R386), T390 (= T387), N393 (= N390)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
45% identity, 90% coverage: 17:405/430 of query aligns to 3:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
38% identity, 84% coverage: 47:407/430 of query aligns to 57:407/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ M79), G89 (= G80), G92 (= G83), A95 (≠ S86), V96 (≠ F87), Y99 (= Y90), M163 (≠ V160), F167 (≠ V164), F293 (= F296), V297 (≠ L300)
- binding aspartic acid: S268 (= S271), S269 (= S272), T306 (= T309), G346 (= G349), I347 (≠ V350), A350 (= A353), G351 (= G354), D380 (= D383), R383 (= R386), T384 (= T387)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
37% identity, 84% coverage: 47:407/430 of query aligns to 49:393/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ V70), S80 (≠ M79), G81 (= G80), G84 (= G83), Y91 (= Y90), M156 (≠ V160), F160 (≠ V164), F286 (= F296), V290 (≠ L300)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V62), I148 (= I152), S262 (= S272), S263 (≠ A273), A292 (≠ T302), T293 (= T303), M296 (= M306), T299 (= T309), G329 (= G346), A336 (= A353), G337 (= G354), D366 (= D383), R369 (= R386), N373 (= N390)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
34% identity, 89% coverage: 47:428/430 of query aligns to 56:484/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (≠ S149) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
35% identity, 84% coverage: 47:409/430 of query aligns to 47:419/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S271), S281 (= S272), T318 (= T309), G363 (= G354), M367 (≠ L358), V385 (≠ A376), D388 (= D379), R395 (= R386), T396 (= T387)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R380)
- binding cholesterol hemisuccinate: R80 (= R81), R84 (≠ K85), I95 (= I96), I252 (≠ V243)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
35% identity, 84% coverage: 47:409/430 of query aligns to 46:420/425 of 7xr4A
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
36% identity, 81% coverage: 47:394/430 of query aligns to 39:388/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (= S65), L58 (= L66), L65 (≠ M73), V339 (≠ I345), G340 (= G346), S343 (≠ G349), I344 (≠ V350)
- binding cholesterol: W188 (≠ K196), I227 (≠ A233), F250 (= F256), W257 (≠ M263), M379 (≠ A385), S382 (≠ V388)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S272), M300 (= M306), T303 (= T309), Y306 (= Y312), G348 (= G354), L349 (= L355), M352 (≠ L358), I366 (≠ V372), L369 (≠ I375), V370 (≠ A376), D373 (= D379), D377 (= D383), R380 (= R386), T381 (= T387), N384 (= N390)
Sites not aligning to the query:
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
32% identity, 89% coverage: 47:427/430 of query aligns to 82:519/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
32% identity, 89% coverage: 47:427/430 of query aligns to 82:519/573 of P31596
- K298 (vs. gap) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (= H235) mutation H->N,T,K,R: No transporter activity.
Query Sequence
>6938665 FitnessBrowser__SB2B:6938665
MSATPPANLWRRWCAVPLWLQILTGMLLGIGVGLVLGPDASALKPIGTLFVNTIKMLIVP
LVFCSLIVGVTSMQDTARMGRIGFKSFAFYLATTAIAISVGLMVGWLLEPGAGLSLEGHD
LSAEVKTAPSVMDTLINIVPTNPVAALASGQILQVIVFAVALGVALVLIGDHGKPAIKVF
ESLAEAMYKLTDMVMKLAPYGVFGLMAWVAGEYGIDMLLPLIKVIIAVYLGCALHILGFY
SLVLKLVAGLSPIQFFKGISNAMAVAFTTSSSAGTLPASMKCASEYLGVNKKISSFVLPL
GTTINMDGTALYQGVTALFVAQAFGVDLTWVDYLTIVLTATLASIGTAGVPGAGLVMLTL
VLTTVGLPLEGVAIIAGIDRILDMARTVVNVSGDLVATTVIARSEGEIDIAHYNADMETS
SEMAQAREDS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory