Comparing 6938692 FitnessBrowser__SB2B:6938692 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
37% identity, 42% coverage: 404:723/761 of query aligns to 6:309/324 of Q5SLR3
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
37% identity, 43% coverage: 404:734/761 of query aligns to 5:317/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
37% identity, 43% coverage: 404:734/761 of query aligns to 5:317/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
37% identity, 43% coverage: 404:734/761 of query aligns to 5:317/323 of 1umbD
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
34% identity, 42% coverage: 421:738/761 of query aligns to 22:322/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
34% identity, 42% coverage: 421:738/761 of query aligns to 22:322/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
34% identity, 42% coverage: 421:738/761 of query aligns to 22:322/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
34% identity, 42% coverage: 421:738/761 of query aligns to 22:322/324 of 1w85B
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
32% identity, 43% coverage: 415:738/761 of query aligns to 18:335/338 of 1qs0B
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
29% identity, 39% coverage: 400:695/761 of query aligns to 69:347/392 of P21953
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
29% identity, 39% coverage: 400:696/761 of query aligns to 6:285/329 of 2j9fD
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
29% identity, 39% coverage: 400:696/761 of query aligns to 3:282/326 of 1dtwB
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
25% identity, 35% coverage: 408:677/761 of query aligns to 39:293/359 of P11177
Sites not aligning to the query:
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
25% identity, 35% coverage: 408:677/761 of query aligns to 10:264/330 of 6cfoB
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
25% identity, 35% coverage: 408:677/761 of query aligns to 11:265/331 of 6cerD
P29803 Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial; PDHE1-A type II; EC 1.2.4.1 from Homo sapiens (Human) (see 4 papers)
23% identity, 42% coverage: 38:357/761 of query aligns to 54:356/388 of P29803
P26284 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Rattus norvegicus (Rat) (see paper)
24% identity, 36% coverage: 84:357/761 of query aligns to 104:358/390 of P26284
P35486 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Mus musculus (Mouse) (see 2 papers)
23% identity, 36% coverage: 84:357/761 of query aligns to 104:358/390 of P35486
6cfoA Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
25% identity, 27% coverage: 154:357/761 of query aligns to 139:330/362 of 6cfoA
Sites not aligning to the query:
1ni4A Human pyruvate dehydrogenase (see paper)
25% identity, 27% coverage: 154:357/761 of query aligns to 139:330/362 of 1ni4A
Sites not aligning to the query:
>6938692 FitnessBrowser__SB2B:6938692
MEDRAIAVERQFIEALETGSVGAFIDNTQGWDHRRLGLSDAEFVGIFESQLKSRLLDLES
RRMRARNEGFYTIGSSGHEGNAAIAAVLNTTDMALLHYRSGAFMVERSRHEASETVLWDM
MLSFAASSEDPISGGRHKVLGSKSLNIPPQTSTIASHLPKAVGVALSIPLTERLGVDGVL
PPDAIAMCNFGDASANHASAQTAINAACWAAFQNIPMPLMFVCEDNGIGISTPTPKGWIG
ANFSQRPGLKYFCCDGLDLLDTYKVAKEAAHWCRSHRQPVFLHVRTVRLMGHAGSDAEIA
YLPKAKILENEALDPLLRSAAMLIEAGVLSAEQILAMYQELKDRIAAIARVAATRPKLTT
AKDAMASVVPPKLANPRAVKTLDEEAFASLFAADKQSLGKPVHMGKLINLTLTELMASHD
NVVVCGEDVGKKGGVYHVTSRLVERFGPSRVINTLLDETSILGLATGMAHNGLLPIPEIQ
FLAYVHNAEDQIRGEAATLPFFSNGQYTNPMVIRIAGLAYQKGFGGHFHNDNSFTVFRDI
PGLILACPSNGADAQGMLRECVRLAREEQRLVIFLEPIALYMTRDLHEPGDSLWAAQYVP
EREATPLPFGEPGRFGEGKDLCIISYGNGYYLSRQAEKALAEAGIDCTLVDLRYLAPLNE
AAICDIAANCRHVLVVDECRRSGSVSEAIVTALHERLGSACPKLARLNAEDCFIPLADAA
TLPLPGKDSIVAAALKLVQGSDAGTGKGTDTGIVIGLEASA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory