SitesBLAST
Comparing 6938711 FitnessBrowser__SB2B:6938711 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4y7uA Structural analysis of muru (see paper)
59% identity, 95% coverage: 1:214/226 of query aligns to 1:212/224 of 4y7uA
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine: L6 (= L6), A7 (= A7), A8 (= A8), G9 (= G9), G11 (= G11), E12 (= E12), R13 (= R13), K23 (= K23), E84 (= E84), D107 (= D107)
- binding 2-acetamido-3-O-[(1R)-1-carboxyethyl]-2-deoxy-1-O-phosphono-alpha-D-glucopyranose: N105 (= N105), D140 (= D144), F160 (= F162), W203 (= W205), D205 (= D207)
- binding magnesium ion: D107 (= D107), D205 (= D207)
Q88QT2 N-acetylmuramate alpha-1-phosphate uridylyltransferase; MurNAc-1P uridylyltransferase; MurNAc-alpha-1P uridylyltransferase; EC 2.7.7.99 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
59% identity, 95% coverage: 1:214/226 of query aligns to 1:212/223 of Q88QT2
- GER 11:13 (= GER 11:13) binding
- K23 (= K23) binding
- N105 (= N105) binding
- D107 (= D107) binding
- D140 (= D144) binding
- D205 (= D207) binding ; binding
4y7vA Structural analysis of muru (see paper)
59% identity, 95% coverage: 1:214/226 of query aligns to 1:207/216 of 4y7vA
P74285 UTP--glucose-1-phosphate uridylyltransferase; Cyanobacterial UDP-glucose pyrophosphorylase; UDP-glucose pyrophosphorylase; UDP-Glc PPase; EC 2.7.7.9 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
30% identity, 96% coverage: 1:217/226 of query aligns to 1:242/388 of P74285
- A8 (= A8) mutation to G: Two-fold decrease in affinity for UTP. No effect on affinity for Glc-1P and on catalytic activity rate.
7whsA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gtp (see paper)
31% identity, 94% coverage: 1:212/226 of query aligns to 1:223/366 of 7whsA
- binding guanosine-5'-triphosphate: L6 (= L6), V7 (≠ A7), G8 (≠ A8), G9 (= G9), G11 (= G11), R13 (= R13), A52 (≠ N52), G85 (≠ E84), N108 (= N105), D110 (= D107)
- binding magnesium ion: D110 (= D107), D218 (= D207)
7d73E Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
43% identity, 49% coverage: 1:111/226 of query aligns to 1:114/360 of 7d73E
- binding guanosine-5'-triphosphate: L6 (= L6), V7 (≠ A7), G8 (≠ A8), G9 (= G9), G11 (= G11), T12 (≠ E12), R13 (= R13), A52 (≠ N52), S54 (≠ A54), E80 (= E79), P83 (≠ A82), G85 (≠ E84), N108 (= N105)
7d72K Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
43% identity, 49% coverage: 1:111/226 of query aligns to 1:114/360 of 7d72K
Sites not aligning to the query:
7d72E Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
43% identity, 49% coverage: 1:111/226 of query aligns to 1:114/360 of 7d72E
Sites not aligning to the query:
7whtA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gdp-mannose (see paper)
33% identity, 94% coverage: 1:212/226 of query aligns to 1:216/360 of 7whtA
- binding guanosine-5'-diphosphate-alpha-d-mannose: L6 (= L6), V7 (≠ A7), G9 (= G9), G11 (= G11), K23 (= K23), P83 (≠ A82), L84 (= L83), N108 (= N105), S109 (≠ G106), D110 (= D107), E159 (= E148), N170 (vs. gap), E192 (≠ G184), W209 (= W205), D211 (= D207)
- binding magnesium ion: D110 (= D107), D211 (= D207)
7x8kA Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
36% identity, 74% coverage: 1:168/226 of query aligns to 1:176/365 of 7x8kA
- binding guanosine-5'-diphosphate-alpha-d-mannose: V7 (≠ A7), G8 (≠ A8), E80 (= E79), G85 (≠ E84), P89 (≠ G88), N109 (= N105), D111 (= D107), G146 (= G143), E162 (vs. gap), N172 (vs. gap), G174 (= G166)
Sites not aligning to the query:
O22287 Mannose-1-phosphate guanylyltransferase 1; GDP-mannose pyrophosphorylase 1; Protein CYTOKINESIS DEFECTIVE 1; Protein EMBRYO DEFECTIVE 101; Protein HYPERSENSITIVE TO AMMONIUM ION 1; Protein SENSITIVE TO OZONE 1; Protein VITAMIN C DEFECTIVE 1; EC 2.7.7.13 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
37% identity, 62% coverage: 1:140/226 of query aligns to 1:145/361 of O22287
- L6 (= L6) binding
- V7 (≠ A7) binding
- G9 (= G9) binding
- G11 (= G11) binding ; mutation to S: In hsn1; reduced enzyme activity, ascorbate concentrations and N-glycosylation, and increased sensitivity to ammonium.
- T12 (≠ E12) binding
- R13 (= R13) binding
- P22 (= P22) mutation to S: In vtc1-1 and vtc1-2; reduced enzyme activity and ascorbate concentrations, and ozone-sensitive.
- K23 (= K23) binding
- D27 (≠ Q27) mutation to E: Abolishes interaction with CSN5B and subsequent degradation in the dark by the 26S proteasome, and increases ascorbate accumulation in seedlings.
- G85 (≠ E84) binding
- P89 (≠ G88) mutation to L: In cyt1-1; deficient in N-glycosylation and cellulose, and embryo lethal.
- N109 (= N105) binding
- D111 (= D107) binding
Sites not aligning to the query:
- 146 binding
- 173 binding
- 223:361 mutation Missing: Reduces catalytic activity 3-fold.
7x8kB Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
37% identity, 62% coverage: 1:140/226 of query aligns to 1:145/367 of 7x8kB
5z09A St0452(y97n)-utp binding form (see paper)
29% identity, 97% coverage: 1:219/226 of query aligns to 1:220/401 of 5z09A
- binding uridine 5'-triphosphate: L6 (= L6), A7 (= A7), A8 (= A8), G9 (= G9), S10 (≠ R10), G11 (= G11), E12 (= E12), R13 (= R13), Q73 (≠ H78), G79 (≠ E84), G98 (= G106), D99 (= D107)
2ggqA Complex of hypothetical glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii
29% identity, 97% coverage: 1:219/226 of query aligns to 1:220/401 of 2ggqA
- active site: R13 (= R13)
- binding thymidine-5'-triphosphate: L6 (= L6), A8 (= A8), G9 (= G9), S10 (≠ R10), G11 (= G11), E12 (= E12), R13 (= R13), K23 (= K23), Q73 (≠ H78), G79 (≠ E84), A83 (≠ G88), R179 (vs. gap), E181 (≠ R180)
Sites not aligning to the query:
Q975F9 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase; EC 2.7.7.24; EC 2.7.7.9; EC 2.7.7.83; EC 2.7.7.23; EC 2.3.1.276; EC 2.3.1.157 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 3 papers)
29% identity, 97% coverage: 1:219/226 of query aligns to 1:220/401 of Q975F9
- AGSGER 8:13 (≠ AGRGER 8:13) binding
- Q73 (≠ H78) binding
- G79 (≠ E84) binding
- T80 (= T85) mutation T->A,G,Q: Increases both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->D,H: Decrease in GlcNAc-1-P UTase activity but increase in Glc-1-P UTase activity.; mutation T->E,K,L,M,R,W,Y: Strong decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.; mutation T->F,I: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->N,S: Strong increase in GlcNAc-1-P UTase activity and decrease in Glc-1-P UTase activity.; mutation to N: Loss of GlcNAc-1-P UTase activity; when associated with V-97.
- Y97 (≠ N105) mutation Y->A,D,F,G,I,K,T,V: Increases GlcNAc-1-P UTase activity. Decreases Glc-1-P UTase activity.; mutation Y->C,E,P,R,W: Decreases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation Y->H,L,M,N,Q,S: Increases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation to V: Loss of GlcNAc-1-P UTase activity; when associated with N-80.
- E146 (≠ S153) mutation E->A,C,F,G,I,K,L,M,P,Q,R,V,W,Y: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->D,N: Decrease in GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->H,S,T: Decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.
Sites not aligning to the query:
- 308 H→A: Strong decrease in GalN-1-P AcTase activity and almost loss of GlcN-1-P AcTase activity.
- 311 Y→A: Strong decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 331 N→A: Strong decrease in GalN-1-P AcTase activity and decrease in GlcN-1-P AcTase activity.
- 337 K→A: Slight decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 340 K→A: Decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 391:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 38% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 16.8 times. Significantly affects the thermostability of the entire protein.
- 397:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 20% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 4.8 times. Does not affect thermostability.
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
29% identity, 94% coverage: 2:214/226 of query aligns to 3:231/293 of 5ifyA
- binding 2'-deoxy-thymidine-beta-l-rhamnose: L7 (= L6), G9 (≠ A8), Q81 (≠ E79), P84 (≠ A82), G86 (≠ E84), L87 (≠ T85), D109 (= D107), Y144 (≠ H140), G145 (≠ P141), E160 (≠ G156), K161 (= K157), V171 (≠ F162), Y175 (≠ G166), R193 (≠ P178)
- binding 2'-deoxyuridine 5'-monophosphate: Y113 (vs. gap), G114 (vs. gap), H115 (vs. gap), D116 (= D111), G217 (≠ D202), R218 (= R203), G219 (vs. gap)
Sites not aligning to the query:
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 94% coverage: 2:214/226 of query aligns to 5:233/292 of P26393
- T201 (≠ G184) mutation to A: Two-fold increase in the conversion of 2-acetamido-2-deoxy-alpha-D-glucopyranosyl phosphate.
- W224 (= W205) mutation to H: Is able to convert both 6-acetamido-6-deoxy-alpha-D-glucopyranosyl phosphate and alpha-D-glucopyranuronic acid 1-(dihydrogen phosphate), which are not accepted by the wild-type.
3pkpB Q83s variant of s. Enterica rmla with datp (see paper)
28% identity, 94% coverage: 2:214/226 of query aligns to 4:232/289 of 3pkpB
- binding 2'-deoxyadenosine 5'-triphosphate: G10 (≠ A8), G11 (= G9), S12 (≠ R10), G13 (= G11), T14 (≠ E12), R15 (= R13), K25 (= K23), Q26 (≠ P24), S82 (≠ E79), P85 (≠ A82), G109 (≠ N105), D110 (≠ G106)
- binding magnesium ion: D110 (≠ G106), D225 (= D207)
3pkpA Q83s variant of s. Enterica rmla with datp (see paper)
28% identity, 94% coverage: 2:214/226 of query aligns to 5:233/290 of 3pkpA
- binding 2'-deoxyadenosine 5'-triphosphate: G11 (≠ A8), G12 (= G9), S13 (≠ R10), G14 (= G11), T15 (≠ E12), R16 (= R13), K26 (= K23), Q27 (≠ P24), S83 (≠ E79), P86 (≠ A82), G110 (≠ N105), D111 (≠ G106)
6jq8A Crystal structure of hddc from yersinia pseudotuberculosis complexed with gmp-pn (see paper)
30% identity, 48% coverage: 3:111/226 of query aligns to 4:112/225 of 6jq8A
- binding aminophosphonic acid-guanylate ester: L7 (= L6), A8 (= A7), G9 (≠ A8), G10 (= G9), S53 (≠ N52), E80 (= E79), P83 (≠ A82), G85 (≠ E84), A89 (≠ G88), N106 (= N105), D108 (= D107)
Query Sequence
>6938711 FitnessBrowser__SB2B:6938711
MKAMILAAGRGERLRPLTDTVPKPLVQAAGKPLIEYHLEKLAAIGVREVIINTAWLGHKL
VETLEDGSRFGLMIQYSHEDEALETAGGILKALPLLGDEPFLVINGDIYIDALPVLSPSP
ELLSGETLAHLYLVDNPPQHPQGDFALEQGILSAEGKPTFTFSGIGIYHPALFRTLAPGR
HALGPLLRQHMNDGRIRGEHFDRYWCDVGTPERLDALNQRLMALGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory