Comparing 6938852 FitnessBrowser__SB2B:6938852 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
40% identity, 87% coverage: 4:220/250 of query aligns to 3:221/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
37% identity, 86% coverage: 4:219/250 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
37% identity, 86% coverage: 4:219/250 of query aligns to 1:223/230 of 1l2tA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
38% identity, 97% coverage: 1:242/250 of query aligns to 1:239/648 of P75831
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
36% identity, 90% coverage: 4:229/250 of query aligns to 3:236/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
36% identity, 90% coverage: 4:229/250 of query aligns to 3:236/592 of 5lj7A
8g4cB Bceabs atpgs high res tm (see paper)
35% identity, 86% coverage: 4:219/250 of query aligns to 3:221/248 of 8g4cB
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
39% identity, 80% coverage: 21:220/250 of query aligns to 16:217/223 of 2pclA
7tchB Bceab e169q variant atp-bound conformation (see paper)
34% identity, 86% coverage: 4:219/250 of query aligns to 2:220/245 of 7tchB
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
39% identity, 88% coverage: 6:226/250 of query aligns to 3:228/650 of 5ws4A
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
37% identity, 84% coverage: 10:219/250 of query aligns to 11:223/233 of P75957
7mdyC Lolcde nucleotide-bound
37% identity, 84% coverage: 10:219/250 of query aligns to 8:220/226 of 7mdyC
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
42% identity, 88% coverage: 3:222/250 of query aligns to 3:218/218 of 7w78A
7arlD Lolcde in complex with lipoprotein and adp (see paper)
37% identity, 84% coverage: 10:219/250 of query aligns to 8:220/222 of 7arlD
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
42% identity, 86% coverage: 3:218/250 of query aligns to 3:214/216 of 7w79A
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
37% identity, 84% coverage: 10:219/250 of query aligns to 10:222/229 of 7v8iD
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 84% coverage: 5:214/250 of query aligns to 4:215/330 of P9WQK5
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
37% identity, 83% coverage: 4:211/250 of query aligns to 2:208/227 of 8igqA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
37% identity, 83% coverage: 4:211/250 of query aligns to 1:207/229 of A5U7B7
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
37% identity, 83% coverage: 4:211/250 of query aligns to 2:208/225 of 8iddA
>6938852 FitnessBrowser__SB2B:6938852
MTPIVAMQEISKSFQDGGERHRVLDNLTLDIHPGETVALTGPSGSGKSTLLNLIAGFDQP
DDGHIRLLGRPSKHFSASDWDRFRRSELGMVFQQFNLLEPLNVQANIHFPLALNGKPWDD
WCHTLTSRLGLTELLSRPVDSLSGGQQQRVAIARALSQRPPLLLADEPTGNLDEHSGDEV
MALLTSLARESNTAILMVTHSERCAAFMQRRWHLCNGQIAETRSEIASPLLGQTTATDGS
LPESSQQVQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory