SitesBLAST
Comparing 6938959 FitnessBrowser__SB2B:6938959 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2rjhA Crystal structure of biosynthetic alaine racemase in d-cycloserine- bound form from escherichia coli (see paper)
58% identity, 97% coverage: 9:361/364 of query aligns to 8:355/359 of 2rjhA
- active site: K34 (= K35), R129 (= R136), H159 (= H166), R209 (= R216), Y255 (= Y261), A302 (≠ S308), D304 (= D310)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K34 (= K35), Y38 (= Y39), R129 (= R136), H159 (= H166), A193 (≠ N200), S194 (= S201), R209 (= R216), G211 (= G218), I212 (= I219), Y255 (= Y261), A302 (≠ S308), M303 (= M309), Y343 (= Y349)
P0A6B4 Alanine racemase, biosynthetic; EC 5.1.1.1 from Escherichia coli (strain K12) (see paper)
58% identity, 97% coverage: 9:361/364 of query aligns to 8:355/359 of P0A6B4
- K34 (= K35) modified: N6-(pyridoxal phosphate)lysine
- K122 (= K129) modified: N6-carboxylysine
- D164 (= D171) mutation to A: Slightly reduces affinity for D-Ala and L-Ala.; mutation to K: Reduces catalytic activity. Slightly reduces affinity for D-Ala and L-Ala.
- E165 (= E172) mutation to A: Slightly reduces affinity for D-Ala and L-Ala.; mutation to K: Reduces catalytic activity. Slightly reduces affinity for D-Ala and L-Ala.
- P219 (= P226) mutation to A: No effect on catalytic activity. No effect on affinity for D-Ala and L-Ala.
- E221 (≠ A228) mutation E->A,K,P: Slightly increases catalytic activity. Slightly increases affinity for D-Ala and L-Ala.
4xbjA Y274f alanine racemase from e. Coli inhibited by l-ala-p (see paper)
58% identity, 97% coverage: 9:361/364 of query aligns to 6:353/357 of 4xbjA
- active site: K32 (= K35), R127 (= R136), H157 (= H166), R207 (= R216), Y253 (= Y261), A300 (≠ S308), D302 (= D310)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: V30 (= V33), K32 (= K35), Y36 (= Y39), R127 (= R136), H157 (= H166), A191 (≠ N200), S192 (= S201), R207 (= R216), G209 (= G218), I210 (= I219), Y253 (= Y261), A300 (≠ S308), M301 (= M309), Y341 (= Y349)
3b8tA Crystal structure of escherichia coli alaine racemase mutant p219a (see paper)
58% identity, 97% coverage: 9:361/364 of query aligns to 8:355/359 of 3b8tA
- active site: K34 (= K35), R129 (= R136), H159 (= H166), R209 (= R216), Y255 (= Y261), A302 (≠ S308), D304 (= D310)
- binding pyridoxal-5'-phosphate: V32 (= V33), K34 (= K35), Y38 (= Y39), L78 (= L85), H159 (= H166), A193 (≠ N200), S194 (= S201), R209 (= R216), G211 (= G218), I212 (= I219), Y343 (= Y349)
6a2fA Crystal structure of biosynthetic alanine racemase from pseudomonas aeruginosa (see paper)
48% identity, 99% coverage: 1:359/364 of query aligns to 1:352/358 of 6a2fA
- active site: K34 (= K35), R130 (= R136), H159 (= H166), R209 (= R216), Y254 (= Y261), S301 (= S308), D303 (= D310)
- binding acetate ion: Y254 (= Y261), R279 (= R286), L340 (≠ I347), Y342 (= Y349)
- binding d-lysine: Y254 (= Y261), Y273 (= Y280), S301 (= S308), M302 (= M309), D303 (= D310), M304 (= M311)
- binding malonate ion: K123 (= K129), R130 (= R136), L131 (= L137)
1rcqA The 1.45 a crystal structure of alanine racemase from a pathogenic bacterium, pseudomonas aeruginosa, contains both internal and external aldimine forms (see paper)
47% identity, 99% coverage: 1:359/364 of query aligns to 1:353/357 of 1rcqA
- active site: K33 (= K35), R129 (= R136), H158 (= H166), R208 (= R216), Y253 (= Y261), S300 (= S308), D302 (= D310)
- binding d-lysine: K33 (= K35), R129 (= R136), Y341 (= Y349)
- binding pyridoxal-5'-phosphate: V31 (= V33), K33 (= K35), Y37 (= Y39), H158 (= H166), N192 (= N200), S193 (= S201), R208 (= R216), G210 (= G218), I211 (= I219), Y341 (= Y349)
Q9HTQ2 Alanine racemase, catabolic; EC 5.1.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
47% identity, 99% coverage: 1:359/364 of query aligns to 1:353/357 of Q9HTQ2
- K33 (= K35) modified: N6-(pyridoxal phosphate)lysine
- K122 (= K129) modified: N6-carboxylysine
3e5pB Crystal structure of alanine racemase from e.Faecalis (see paper)
35% identity, 97% coverage: 6:359/364 of query aligns to 10:366/371 of 3e5pB
- active site: K40 (= K35), R139 (= R136), H169 (= H166), R222 (= R216), Y267 (= Y261), C313 (≠ S308), D315 (= D310)
- binding pyridoxal-5'-phosphate: K40 (= K35), Y44 (= Y39), R139 (= R136), H169 (= H166), S207 (= S201), G224 (= G218), V225 (≠ I219), Y356 (= Y349)
3e6eA Crystal structure of alanine racemase from e.Faecalis complex with cycloserine (see paper)
35% identity, 97% coverage: 6:359/364 of query aligns to 9:365/370 of 3e6eA
- active site: K39 (= K35), R138 (= R136), H168 (= H166), R221 (= R216), Y266 (= Y261), C312 (≠ S308), D314 (= D310)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K39 (= K35), Y43 (= Y39), L85 (= L85), R138 (= R136), H168 (= H166), S206 (= S201), R221 (= R216), G223 (= G218), V224 (≠ I219), Y266 (= Y261), Y285 (= Y280), M313 (= M309), Y355 (= Y349)
6sczA Mycobacterium tuberculosis alanine racemase inhibited by dcs (see paper)
37% identity, 95% coverage: 13:359/364 of query aligns to 12:366/373 of 6sczA
- active site: K34 (= K35), R132 (= R136), H164 (= H166), R220 (= R216), Y263 (= Y261), C310 (≠ S308), D312 (= D310)
- binding (~{E})-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylidene-[(4~{R})-3-oxidanylidene-1,2-oxazolidin-4-yl]azanium: K34 (= K35), Y38 (= Y39), W80 (≠ L85), H164 (= H166), S205 (= S201), R220 (= R216), G222 (= G218), I223 (= I219), Y356 (= Y349)
- binding [2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methyl-(3-oxidanyl-1,2-oxazol-4-yl)azanium: Y38 (= Y39), W80 (≠ L85), H164 (= H166), N204 (= N200), S205 (= S201), R220 (= R216), G222 (= G218), I223 (= I219), Y263 (= Y261), Y282 (= Y280), M311 (= M309), Y356 (= Y349)
- binding polyethylene glycol: D172 (≠ Q174), A210 (≠ Y206), P212 (= P208)
P9WQA9 Alanine racemase; EC 5.1.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 95% coverage: 13:359/364 of query aligns to 20:374/384 of P9WQA9
- K42 (= K35) modified: N6-(pyridoxal phosphate)lysine
5fajA Alanine racemase from streptomyces coelicolor a3(2) in complex with d- cycloserine (see paper)
36% identity, 97% coverage: 6:359/364 of query aligns to 11:378/385 of 5fajA
- active site: I14 (= I9), K40 (= K35), A41 (= A36), R142 (= R136), H175 (= H166), R231 (= R216), Y277 (= Y261), A324 (≠ S308), D326 (= D310)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K40 (= K35), Y44 (= Y39), W90 (≠ R81), W173 (≠ M164), H175 (= H166), N215 (= N200), S216 (= S201), R231 (= R216), P232 (= P217), G233 (= G218), I234 (= I219), Y277 (= Y261), Y296 (= Y280), M325 (= M309), Y368 (= Y349)
5fagA Alanine racemase from streptomyces coelicolor a3(2) with bound propionate inhibitor (see paper)
36% identity, 97% coverage: 6:359/364 of query aligns to 16:383/390 of 5fagA
- active site: I19 (= I9), K45 (= K35), A46 (= A36), R147 (= R136), H180 (= H166), R236 (= R216), Y282 (= Y261), A329 (≠ S308), D331 (= D310)
- binding pyridoxal-5'-phosphate: K45 (= K35), Y49 (= Y39), W95 (≠ R81), W178 (≠ M164), H180 (= H166), N220 (= N200), S221 (= S201), R236 (= R216), G238 (= G218), I239 (= I219), Y373 (= Y349)
6q70A Crystal structure of the alanine racemase bsu17640 from bacillus subtilis in the presence of hepes (see paper)
34% identity, 97% coverage: 8:359/364 of query aligns to 11:374/386 of 6q70A
- active site: K39 (= K35), R139 (= R136), H169 (= H166), R225 (= R216), Y272 (= Y261), T319 (≠ S308), D321 (= D310)
- binding pyridoxal-5'-phosphate: V37 (= V33), K39 (= K35), Y43 (= Y39), L85 (= L85), R139 (= R136), H169 (= H166), T210 (≠ S201), R225 (= R216), G227 (= G218), I228 (= I219), Y364 (= Y349)
5irpA Crystal structure of the alanine racemase bsu17640 from bacillus subtilis (see paper)
34% identity, 97% coverage: 8:359/364 of query aligns to 11:374/386 of 5irpA
- active site: K39 (= K35), R139 (= R136), H169 (= H166), R225 (= R216), Y272 (= Y261), T319 (≠ S308), D321 (= D310)
- binding magnesium ion: L155 (= L151), K156 (≠ Q152), S158 (≠ N154), L161 (≠ A158)
- binding 2-amino-2-hydroxymethyl-propane-1,3-diol: D174 (= D171), P235 (= P226), Y364 (= Y349)
- binding (5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y43 (= Y39), L85 (= L85), R139 (= R136), H169 (= H166), N209 (= N200), T210 (≠ S201), R225 (= R216), G227 (= G218), I228 (= I219), Y364 (= Y349)
P0A2W8 Alanine racemase; EC 5.1.1.1 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
36% identity, 99% coverage: 1:359/364 of query aligns to 1:362/367 of P0A2W8
- K129 (= K129) modified: N6-carboxylysine
6g58A Structure of the alanine racemase from staphylococcus aureus in complex with a pyridoxal 5' phosphate-derivative (see paper)
35% identity, 95% coverage: 13:359/364 of query aligns to 17:364/382 of 6g58A
- active site: K39 (= K35), R138 (= R136), H168 (= H166), R219 (= R216), Y265 (= Y261), C311 (≠ S308), D313 (= D310)
- binding (6-but-3-ynyl-4-methyl-5-oxidanyl-pyridin-3-yl)methyl dihydrogen phosphate: K39 (= K35), Y43 (= Y39), L85 (= L85), K131 (= K129), R138 (= R136), H168 (= H166), S204 (= S201), R219 (= R216), G221 (= G218), I222 (= I219), Y354 (= Y349)
6g59A Structure of the alanine racemase from staphylococcus aureus in complex with an pyridoxal-6- phosphate derivative (see paper)
35% identity, 95% coverage: 13:359/364 of query aligns to 22:369/387 of 6g59A
- active site: K44 (= K35), R143 (= R136), H173 (= H166), R224 (= R216), Y270 (= Y261), C316 (≠ S308), D318 (= D310)
- binding (6-ethynyl-4-methanoyl-5-oxidanyl-pyridin-3-yl)methyl dihydrogen phosphate: K44 (= K35), Y48 (= Y39), L90 (= L85), H173 (= H166), S209 (= S201), R224 (= R216), G226 (= G218), I227 (= I219), Y359 (= Y349)
1xfcA The 1.9 a crystal structure of alanine racemase from mycobacterium tuberculosis contains a conserved entryway into the active site (see paper)
37% identity, 95% coverage: 13:359/364 of query aligns to 10:359/366 of 1xfcA
- active site: K32 (= K35), R130 (= R136), H162 (= H166), R213 (= R216), C303 (≠ S308), D305 (= D310)
- binding pyridoxal-5'-phosphate: K32 (= K35), Y36 (= Y39), W78 (≠ L85), H162 (= H166), S198 (= S201), R213 (= R216), G215 (= G218), I216 (= I219), Y349 (= Y349)
1vfsA Crystal structure of d-cycloserine-bound form of alanine racemase from d-cycloserine-producing streptomyces lavendulae (see paper)
36% identity, 97% coverage: 7:359/364 of query aligns to 8:369/383 of 1vfsA
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K36 (= K35), Y40 (= Y39), W82 (≠ L85), R134 (= R136), H166 (= H166), S207 (= S201), R222 (= R216), G224 (= G218), Y268 (= Y261), Y287 (= Y280), M316 (= M309), Y359 (= Y349)
Query Sequence
>6938959 FitnessBrowser__SB2B:6938959
MKPFPRAEISSRALKANLKRLRQIAPGSKVMAVVKANGYGHGLLNVAEVLTDAHSNADAD
GFGLARLEEALEVRAGGVSARLLLLEGFFRSEDLPLLVEHDIDTVVHHVSQLDMLESVSL
SKPVTVWLKIDSGMHRLGFHASEFKDVYQRLQQNPNVAKPVHLMTHFSCADEPQKDFTAT
QMAHFNALTQGLPGDRTLANSAGVLYWPQSQADWIRPGIALYGVSPVAGDLGSNHGLEPA
MELVSQLIAVREHSAGESVGYGAYWTASRDTRLGVVAIGYGDGYPRNAPEGTPVLVNGRR
VPIVGRVSMDMLTVDLGPDAADKVGDRALLWGKELPVEEVAERIGTIAYELVTKLTPRVA
VCLD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory