Comparing 6938992 FitnessBrowser__SB2B:6938992 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
28% identity, 98% coverage: 2:145/147 of query aligns to 501:646/650 of O31645
Sites not aligning to the query:
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
22% identity, 72% coverage: 42:147/147 of query aligns to 530:635/637 of P00550
Sites not aligning to the query:
>6938992 FitnessBrowser__SB2B:6938992
MELSTILAPECTSCATPGSKKKVLELISDLAAAQNPSLSSQEIFESLLAREKMGSTGIGN
GIAIPHGRLGTIDKPLAVLIKCEEAIGYDAIDKQPVDILFALLVPSDQCQQHLSTLAAMA
EKLNDKQILKQLRKSHDEKELYQVIIG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory