Comparing 6939072 FitnessBrowser__SB2B:6939072 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 98% coverage: 6:790/797 of query aligns to 91:908/916 of O81852
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
33% identity, 45% coverage: 438:794/797 of query aligns to 3:358/358 of 1tveA
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
33% identity, 45% coverage: 438:794/797 of query aligns to 3:358/358 of 1q7gA
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
33% identity, 45% coverage: 438:794/797 of query aligns to 3:358/358 of 1ebuD
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
33% identity, 45% coverage: 438:794/797 of query aligns to 3:358/358 of 1ebfA
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 45% coverage: 438:794/797 of query aligns to 4:359/359 of P31116
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 42% coverage: 437:767/797 of query aligns to 5:341/376 of O94671
P08660 Lysine-sensitive aspartokinase 3; Aspartate kinase III; AKIII; Lysine-sensitive aspartokinase III; EC 2.7.2.4 from Escherichia coli (strain K12) (see paper)
35% identity, 36% coverage: 1:290/797 of query aligns to 1:289/449 of P08660
2j0xA Crystal structure of e. Coli aspartokinase iii in complex with lysine and aspartate (t-state) (see paper)
36% identity, 36% coverage: 6:290/797 of query aligns to 4:287/447 of 2j0xA
Sites not aligning to the query:
2j0wA Crystal structure of e. Coli aspartokinase iii in complex with aspartate and adp (r-state) (see paper)
36% identity, 36% coverage: 6:290/797 of query aligns to 4:287/447 of 2j0wA
2hmfA Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate (see paper)
26% identity, 48% coverage: 6:386/797 of query aligns to 3:406/464 of 2hmfA
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
28% identity, 39% coverage: 6:313/797 of query aligns to 3:322/468 of 3c1mC
3c1nA Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine (see paper)
26% identity, 48% coverage: 6:386/797 of query aligns to 3:401/458 of 3c1nA
Sites not aligning to the query:
2cdqA Crystal structure of arabidopsis thaliana aspartate kinase complexed with lysine and s-adenosylmethionine (see paper)
32% identity, 36% coverage: 8:293/797 of query aligns to 8:300/470 of 2cdqA
Sites not aligning to the query:
3tviE Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production (see paper)
25% identity, 36% coverage: 8:290/797 of query aligns to 7:275/439 of 3tviE
O60163 Probable aspartokinase; Aspartate kinase; EC 2.7.2.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 22% coverage: 117:294/797 of query aligns to 141:320/519 of O60163
Sites not aligning to the query:
3tviA Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production (see paper)
24% identity, 36% coverage: 8:290/797 of query aligns to 5:267/429 of 3tviA
Sites not aligning to the query:
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
30% identity, 30% coverage: 438:675/797 of query aligns to 1:232/319 of 3ingA
Sites not aligning to the query:
3l76A Crystal structure of aspartate kinase from synechocystis (see paper)
27% identity, 36% coverage: 6:292/797 of query aligns to 4:233/585 of 3l76A
Sites not aligning to the query:
P61489 Aspartokinase; Aspartate kinase; AK; ASK; Threonine-sensitive AK; ThrA; EC 2.7.2.4 from Thermus thermophilus (see paper)
35% identity, 17% coverage: 181:316/797 of query aligns to 132:271/405 of P61489
Sites not aligning to the query:
>6939072 FitnessBrowser__SB2B:6939072
MARCHLHKFGGSSLADADCYRRVAHILLTQGHSDDLVVVSAAGKTTNFLYKLLSLRDAGE
LWQEELQVLISYQQNLIEQLLSAEQARYLRERLSTDKAQLVSLLSLATLNDYQTSHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEGAVPNIREQESREKVAAMLAEHENERI
VITGFICANPAGETLLLGRNGSDFSATLIASLADIERVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTQVSMAVRSSYAPHTDFTLVAPTSSQASAP
VVTNLSEVALFSLTTQADTDALLATLSASGLTPLASWQGSRGGLELAYTPENLKQVSAFL
KANAEAYGLGDVSISNDFGLVALVSADAVLYRKSFARLLSREAKPLYHDTLSLVTLVPKA
QVNLLTQKVHRRCAGPRKRIGVILLGVGNIGEAWVSLFRRAQSSLCRELEARIELVGLVS
SSRAYINNAGVHLENWKTEFEEYATDWQYGQLFEALSTLNCDELVALDISASASLTLQYP
EFFARGIHVVSANKLAGSGPLPFYRDLKQQLGNRRLYWRYNASCGAGLPVQHALNDLHNS
GDSVEAVGGIFSGTLCWLFEHYDGQRPFSDLVIEARGLGITEPDPRDDLSGRDMQRKLLI
LAREIGLDLELDDIQVESPVPPHLAELTLDEFLARIDELDAPMADALAAAAAEGKVLRYI
AALDRAGGQLMARVGLQWVDKAHPYANLTPGDNVFVIRSTFYQGNPLIIRGPGAGREVTA
AAVQSDLVQICRDLLQD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory