SitesBLAST
Comparing 6939098 FitnessBrowser__SB2B:6939098 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vr1A Crystal structure of biotin carboxylase from e. Coli in complex with atp analog, adpcf2p. (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:439/444 of 2vr1A
- active site: K116 (= K121), K159 (= K164), D194 (≠ N201), H207 (= H214), R233 (= R239), T272 (= T278), E274 (= E280), E286 (= E292), N288 (= N294), R290 (= R296), E294 (= E300), R336 (= R339)
- binding phosphodifluoromethylphosphonic acid-adenylate ester: K159 (= K164), R165 (= R172), M167 (= M174), Y201 (≠ F208), L202 (= L209), E274 (= E280), L276 (= L282), E286 (= E292), N288 (= N294), I435 (= I438)
3rupA Crystal structure of e.Coli biotin carboxylase in complex with two adp and two ca ions (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/444 of 3rupA
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding adenosine-5'-diphosphate: Y82 (= Y87), G83 (= G88), K116 (= K121), K159 (= K164), G164 (= G169), G164 (= G169), G165 (= G170), G166 (= G171), R167 (= R172), M169 (= M174), F193 (= F198), E201 (= E206), K202 (= K207), Y203 (≠ F208), L204 (= L209), H209 (= H214), Q233 (= Q237), H236 (= H240), K238 (= K242), L278 (= L282), E288 (= E292), R292 (= R296), V295 (= V299), E296 (= E300), R338 (= R339), D382 (= D383), I437 (= I438)
- binding calcium ion: E87 (= E92), E276 (= E280), E288 (= E292), E288 (= E292), N290 (= N294)
3g8cA Crystal structure of biotin carboxylase in complex with biotin, bicarbonate, adp and mg ion (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/444 of 3g8cA
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding adenosine-5'-diphosphate: I157 (≠ L162), K159 (= K164), G164 (= G169), M169 (= M174), E201 (= E206), K202 (= K207), Y203 (≠ F208), L204 (= L209), Q233 (= Q237), H236 (= H240), L278 (= L282), E288 (= E292), I437 (= I438)
- binding bicarbonate ion: K238 (= K242), R292 (= R296), Q294 (= Q298), V295 (= V299), E296 (= E300)
- binding biotin: Y82 (= Y87), F84 (= F89), R292 (= R296), V295 (= V299), R338 (= R339), D382 (= D383)
- binding magnesium ion: E276 (= E280), E288 (= E292)
P24182 Biotin carboxylase; Acetyl-coenzyme A carboxylase biotin carboxylase subunit A; EC 6.3.4.14 from Escherichia coli (strain K12) (see 3 papers)
57% identity, 96% coverage: 9:442/454 of query aligns to 4:441/449 of P24182
- R19 (= R24) mutation to E: Loss of homodimerization. No effect on ATP binding.
- E23 (≠ Q28) mutation to R: Loss of homodimerization. No effect on ATP binding.
- K116 (= K121) binding ATP
- K159 (= K164) binding ATP
- GG 165:166 (= GG 170:171) binding ATP
- EKYL 201:204 (≠ EKFL 206:209) binding ATP
- H209 (= H214) binding ATP
- H236 (= H240) binding ATP
- K238 (= K242) binding hydrogencarbonate
- E276 (= E280) binding ATP; binding Mg(2+)
- E288 (= E292) binding ATP; binding Mg(2+)
- R292 (= R296) active site; binding hydrogencarbonate
- V295 (= V299) binding hydrogencarbonate
- E296 (= E300) mutation to A: Severe reduction in catalytic activity.
- R338 (= R339) binding biotin; binding hydrogencarbonate; mutation to A: Severe reduction in catalytic activity.
- F363 (≠ P364) mutation to A: Loss of homodimerization. No effect on ATP binding.
- R366 (= R367) mutation to E: Loss of homodimerization. No effect on ATP binding.
3jziA Crystal structure of biotin carboxylase from e. Coli in complex with benzimidazole series (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/445 of 3jziA
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding 7-amino-2-[(2-chlorobenzyl)amino]-1-{[(1S,2S)-2-hydroxycycloheptyl]methyl}-1H-benzimidazole-5-carboxamide: K116 (= K121), K159 (= K164), A160 (= A165), G164 (= G169), G165 (= G170), M169 (= M174), Y199 (= Y204), E201 (= E206), K202 (= K207), Y203 (≠ F208), H209 (= H214), Q233 (= Q237), H236 (= H240), L278 (= L282), I287 (= I291), E288 (= E292)
2w6oA Crystal structure of biotin carboxylase from e. Coli in complex with 4-amino-7,7-dimethyl-7,8-dihydro-quinazolinone fragment (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/445 of 2w6oA
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding 4-amino-7,7-dimethyl-7,8-dihydroquinazolin-5(6H)-one: K159 (= K164), K202 (= K207), Y203 (≠ F208), L204 (= L209), L278 (= L282), I437 (= I438)
2w6nA Crystal structure of biotin carboxylase from e. Coli in complex with amino-oxazole fragment series (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/445 of 2w6nA
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding 2-amino-n,n-bis(phenylmethyl)-1,3-oxazole-5-carboxamide: I157 (≠ L162), K159 (= K164), M169 (= M174), E201 (= E206), K202 (= K207), Y203 (≠ F208), L278 (= L282)
2v59A Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 2 (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/445 of 2v59A
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding 6-(2,6-dimethoxyphenyl)pyrido[2,3-d]pyrimidine-2,7-diamine: K159 (= K164), Y203 (≠ F208), L204 (= L209), H209 (= H214), Q233 (= Q237), H236 (= H240), L278 (= L282), I437 (= I438)
3jzfB Crystal structure of biotin carboxylase from e. Coli in complex with benzimidazoles series (see paper)
57% identity, 96% coverage: 9:442/454 of query aligns to 6:443/447 of 3jzfB
- active site: K118 (= K121), K161 (= K164), D198 (≠ N201), H211 (= H214), R237 (= R239), T276 (= T278), E278 (= E280), E290 (= E292), N292 (= N294), R294 (= R296), E298 (= E300), R340 (= R339)
- binding 2-[(2-chlorobenzyl)amino]-1-(cyclohexylmethyl)-1H-benzimidazole-5-carboxamide: K118 (= K121), K161 (= K164), A162 (= A165), G166 (= G169), G168 (= G171), R169 (= R172), G170 (= G173), M171 (= M174), Y201 (= Y204), E203 (= E206), K204 (= K207), Y205 (≠ F208), H211 (= H214), H238 (= H240), L280 (= L282), I289 (= I291), E290 (= E292)
8uz2C E. Coli acetyl-coa carboxylase, narrow helical local reconstruction, 3.18 angstrom
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/446 of 8uz2C
- binding adenosine-5'-diphosphate: K116 (= K121), K159 (= K164), G164 (= G169), G165 (= G170), G166 (= G171), M169 (= M174), H209 (= H214), Q233 (= Q237), H236 (= H240), L278 (= L282), E288 (= E292), I437 (= I438)
- binding magnesium ion: E276 (= E280), E288 (= E292)
- binding : R356 (≠ Q357), I410 (≠ E411)
6oi9A Crystal structure of e. Coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/446 of 6oi9A
- active site: E276 (= E280), E288 (= E292), N290 (= N294), E296 (= E300), R338 (= R339)
- binding 7-[(3S)-3-(aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3-d]pyrimidin-2-amine: K159 (= K164), M169 (= M174), E201 (= E206), Y203 (≠ F208), L204 (= L209), H209 (= H214), Q233 (= Q237), H236 (= H240), E276 (= E280), L278 (= L282), E288 (= E292), I437 (= I438)
2w71A Crystal structure of biotin carboxylase from e. Coli in complex with the imidazole-pyrimidine inhibitor (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/446 of 2w71A
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding 4-[1-(2,6-dichlorobenzyl)-2-methyl-1H-imidazol-4-yl]pyrimidin-2-amine: K159 (= K164), Y203 (≠ F208), L204 (= L209), H209 (= H214), Q233 (= Q237), H236 (= H240), L278 (= L282), I437 (= I438)
2w70A Crystal structure of biotin carboxylase from e. Coli in complex with the amino-thiazole-pyrimidine fragment (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/446 of 2w70A
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding 4-(2-amino-1,3-thiazol-4-yl)pyrimidin-2-amine: I157 (≠ L162), K159 (= K164), G166 (= G171), M169 (= M174), E201 (= E206), Y203 (≠ F208), L204 (= L209), L278 (= L282)
2w6zA Crystal structure of biotin carboxylase from e. Coli in complex with the 3-(3-methyl-but-2-enyl)-3h-purin-6-ylamine fragment (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/446 of 2w6zA
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding 3-(3-methylbut-2-en-1-yl)-3H-purin-6-amine: K159 (= K164), Y203 (≠ F208), L204 (= L209), L278 (= L282)
2w6qA Crystal structure of biotin carboxylase from e. Coli in complex with the triazine-2,4-diamine fragment (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/446 of 2w6qA
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding 6-(2-phenoxyethoxy)-1,3,5-triazine-2,4-diamine: I157 (≠ L162), K159 (= K164), E201 (= E206), K202 (= K207), Y203 (≠ F208), L204 (= L209), H236 (= H240), L278 (= L282)
2w6pA Crystal structure of biotin carboxylase from e. Coli in complex with 5-methyl-6-phenyl-quinazoline-2,4-diamine (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/446 of 2w6pA
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding 5-methyl-6-phenylquinazoline-2,4-diamine: K159 (= K164), Y203 (≠ F208), L204 (= L209), Q233 (= Q237), H236 (= H240), L278 (= L282), I437 (= I438)
2w6mA Crystal structure of biotin carboxylase from e. Coli in complex with amino-oxazole fragment series (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/446 of 2w6mA
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding (2-amino-1,3-oxazol-5-yl)-(3-bromophenyl)methanone: I157 (≠ L162), K159 (= K164), M169 (= M174), E201 (= E206), K202 (= K207), Y203 (≠ F208), H236 (= H240), L278 (= L282), I437 (= I438)
2v5aA Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 3 (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/446 of 2v5aA
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding 7-(2,5-dihydropyrrol-1-yl)-6-phenyl-pyrido[6,5-d]pyrimidin-2-amine: I157 (≠ L162), K159 (= K164), M169 (= M174), E201 (= E206), Y203 (≠ F208), L204 (= L209), Q233 (= Q237), H236 (= H240), L278 (= L282), I437 (= I438)
2v58A Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 1 (see paper)
56% identity, 96% coverage: 7:442/454 of query aligns to 2:441/446 of 2v58A
- active site: K116 (= K121), K159 (= K164), D196 (≠ N201), H209 (= H214), R235 (= R239), T274 (= T278), E276 (= E280), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R339)
- binding 6-(2,6-dibromophenyl)pyrido[2,3-d]pyrimidine-2,7-diamine: I157 (≠ L162), K159 (= K164), E201 (= E206), Y203 (≠ F208), L204 (= L209), H209 (= H214), Q233 (= Q237), H236 (= H240), L278 (= L282), I437 (= I438)
4mv4A Crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and mg2 (see paper)
54% identity, 96% coverage: 7:442/454 of query aligns to 2:438/442 of 4mv4A
- active site: K116 (= K121), K159 (= K164), D193 (≠ N201), H206 (= H214), R232 (= R239), T271 (= T278), E273 (= E280), E285 (= E292), N287 (= N294), R289 (= R296), E293 (= E300), R335 (= R339)
- binding phosphomethylphosphonic acid adenylate ester: K159 (= K164), G164 (= G169), M166 (= M174), E198 (= E206), Y200 (≠ F208), L201 (= L209), H233 (= H240), L275 (= L282), E285 (= E292)
- binding magnesium ion: E273 (= E280), E285 (= E292)
Query Sequence
>6939098 FitnessBrowser__SB2B:6939098
MPTEARFKRVLVANRGEIAVRIIRACHQLGLETVAIYSSADKGALHTLLATHCLCIGPAA
AKDSYLNINAILEAAKLTAADAIHPGYGFLAERAGFARAVTEAGLVFLGPDADTIATMGD
KVSAIKSIKAVGIPTLPGSDGALNDDMNAVEALATDIGYPVLIKASAGGGGRGMRRVDSA
DELASAIALTRSEALAAFGDNTVYLEKFLTHPRHIEFQMLADGEAALCLGERDCSAQRRH
QKLIEEAPALGIAREKIREMADICEAACRRLGYRGVGTFEFLYQDGAFFFIEMNTRIQVE
HTVTEMVTGLDLIAWQLKVALGHPLPPRPQVQGHAIECRINAEAPQSQLPSPGVITQLRV
PGGPGVRWDSYLFPGAMVPAFYDSLIGKLICHGVTREEATARLRQALTELEIQGIAINKS
LHLQLIACDAFQPWQRDIHFVDALSAPGVGQAHL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory