Comparing 6939103 FitnessBrowser__SB2B:6939103 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
29% identity, 44% coverage: 47:197/345 of query aligns to 21:152/293 of 3pzlB
Sites not aligning to the query:
4mynA Crystal structure of trypanosoma cruzi formiminoglutamase n114h variant with mn2+2 (see paper)
25% identity, 72% coverage: 33:280/345 of query aligns to 2:241/298 of 4mynA
Sites not aligning to the query:
>6939103 FitnessBrowser__SB2B:6939103
MQHLIIFSAKDMTPILGKRPGETRLGNHFLLPEGPTLVAILESAKAQGARFVLLGVGEDA
GPRANLGRGGATNAFEAMLKYLVNLQSNRFYRGDDCLLLGQLDFGDLLPGEDADVDALRA
AVAAMDERVIEVASAIMEAGLEPIVIGGGHNNAFGLLMSVKNAFGRPAAAVNLDPHSDFR
LREGRHSGNGFSYAAASGALDFYHVLGLHELKNSEANLEQLAAFGGSWHTLQQIWVRGEL
SLDDALKHIGKTLRATGLPVALELDLDAIANMPSSAMTAAGVPLLDAARYISHIARHCDC
AYLHLAEAAPSCHDSGEDAGLRETGQSLTELVYAYIRGRHLALGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory