SitesBLAST
Comparing 6939184 FitnessBrowser__SB2B:6939184 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
61% identity, 95% coverage: 24:528/531 of query aligns to 16:512/514 of P04968
- K62 (= K70) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N97) binding
- GGGGL 188:192 (= GGGGL 196:200) binding
- S315 (= S330) binding
8y1jA Structure of the pyridoxal 5'-phosphate-dependent (plp) threonine deaminase ilva1 from pseudomonas aeruginosa pao1 (see paper)
57% identity, 95% coverage: 24:528/531 of query aligns to 4:502/502 of 8y1jA
- binding 2-ketobutyric acid: K50 (= K70), S74 (= S94), H78 (= H98), E336 (= E362), R337 (≠ V363), P338 (= P364), S340 (= S366), F341 (= F367), Y358 (= Y384), N448 (= N474), I449 (= I475)
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
59% identity, 95% coverage: 24:528/531 of query aligns to 12:492/494 of 1tdjA
- active site: K58 (= K70), A83 (= A95), E209 (= E221), S213 (≠ A225), C215 (= C227), G237 (= G249), L310 (= L329), S311 (= S330)
- binding pyridoxal-5'-phosphate: F57 (= F69), K58 (= K70), N85 (= N97), G184 (= G196), G185 (= G197), G186 (= G198), G187 (= G199), G237 (= G249), E282 (= E294), S311 (= S330), G312 (= G331)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
40% identity, 56% coverage: 48:343/531 of query aligns to 34:322/326 of 2gn2A
- active site: K56 (= K70), A81 (= A95), Q207 (≠ E221), V211 (≠ A225), G213 (≠ C227), G235 (= G249), I308 (≠ L329), S309 (= S330)
- binding cytidine-5'-monophosphate: R51 (≠ P65), T52 (≠ V66), G53 (≠ H67), A114 (= A128), D117 (≠ R131), Y118 (≠ R132), N312 (= N333)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
34% identity, 56% coverage: 40:339/531 of query aligns to 38:332/339 of Q7XSN8
- E219 (= E221) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ C227) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
34% identity, 58% coverage: 32:338/531 of query aligns to 15:318/320 of 7nbhAAA
- active site: K53 (= K70), S81 (≠ A95), E207 (= E221), A211 (= A225), D213 (≠ A226), G236 (= G249), L309 (= L329), S310 (= S330)
- binding calcium ion: E207 (= E221), A211 (= A225), D213 (≠ A226)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A95), G85 (≠ A99), Q86 (= Q100), K111 (= K125), I115 (≠ V129), Y118 (≠ R132), D235 (= D248), P281 (= P295), N313 (= N333), V314 (= V334), D315 (≠ N335)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
34% identity, 58% coverage: 32:338/531 of query aligns to 15:318/323 of 7nbfAAA
- active site: K53 (= K70), S81 (≠ A95), E207 (= E221), A211 (= A225), D213 (≠ A226), G236 (= G249), L309 (= L329), S310 (= S330)
- binding calcium ion: E207 (= E221), A211 (= A225), D213 (≠ A226)
- binding magnesium ion: N244 (≠ E258)
- binding pyridoxal-5'-phosphate: F52 (= F69), K53 (= K70), N83 (= N97), G182 (= G196), G183 (= G197), G184 (= G198), G185 (= G199), M186 (≠ L200), G236 (= G249), V237 (= V250), T282 (≠ A296), S310 (= S330), G311 (= G331)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ K38), L22 (≠ V39), T23 (= T40), P24 (= P41), L26 (≠ S43), T27 (≠ H44), F46 (≠ M63)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
34% identity, 58% coverage: 32:338/531 of query aligns to 15:318/323 of 7nbdAAA
- active site: K53 (= K70), S81 (≠ A95), E207 (= E221), A211 (= A225), D213 (≠ A226), G236 (= G249), L309 (= L329), S310 (= S330)
- binding calcium ion: E207 (= E221), A211 (= A225), D213 (≠ A226)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ F286), L278 (≠ I292), V314 (= V334), L316 (≠ F336)
- binding magnesium ion: N244 (≠ E258)
- binding pyridoxal-5'-phosphate: F52 (= F69), K53 (= K70), N83 (= N97), G182 (= G196), G183 (= G197), G184 (= G198), G185 (= G199), M186 (≠ L200), G236 (= G249), V237 (= V250), E280 (= E294), T282 (≠ A296), S310 (= S330), G311 (= G331)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
34% identity, 58% coverage: 32:338/531 of query aligns to 15:318/323 of 7nbcCCC
- active site: K53 (= K70), S81 (≠ A95), E207 (= E221), A211 (= A225), D213 (≠ A226), G236 (= G249), L309 (= L329), S310 (= S330)
- binding biphenyl-4-ylacetic acid: T78 (≠ C92), H79 (≠ A93), H84 (= H98), V148 (≠ I162), H149 (≠ A163), P150 (= P164)
- binding calcium ion: E207 (= E221), A211 (= A225), D213 (≠ A226)
- binding pyridoxal-5'-phosphate: F52 (= F69), K53 (= K70), N83 (= N97), G182 (= G196), G183 (= G197), G184 (= G198), G185 (= G199), M186 (≠ L200), G236 (= G249), V237 (= V250), T282 (≠ A296), S310 (= S330), G311 (= G331)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
34% identity, 58% coverage: 32:338/531 of query aligns to 15:318/323 of 7nbcAAA
- active site: K53 (= K70), S81 (≠ A95), E207 (= E221), A211 (= A225), D213 (≠ A226), G236 (= G249), L309 (= L329), S310 (= S330)
- binding calcium ion: E207 (= E221), A211 (= A225), D213 (≠ A226)
- binding magnesium ion: N244 (≠ E258)
- binding pyridoxal-5'-phosphate: F52 (= F69), K53 (= K70), N83 (= N97), G182 (= G196), G183 (= G197), G184 (= G198), G185 (= G199), M186 (≠ L200), G236 (= G249), V237 (= V250), T282 (≠ A296), S310 (= S330), G311 (= G331)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
34% identity, 58% coverage: 32:338/531 of query aligns to 15:318/322 of 7nbgAAA
- active site: K53 (= K70), S81 (≠ A95), E207 (= E221), A211 (= A225), D213 (≠ A226), G236 (= G249), L309 (= L329), S310 (= S330)
- binding calcium ion: E207 (= E221), A211 (= A225), D213 (≠ A226)
- binding pyridoxal-5'-phosphate: F52 (= F69), K53 (= K70), N83 (= N97), G182 (= G196), G183 (= G197), G184 (= G198), G185 (= G199), M186 (≠ L200), G236 (= G249), V237 (= V250), T282 (≠ A296), S310 (= S330), G311 (= G331)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A95), G85 (≠ A99), Q86 (= Q100), I101 (= I115), K111 (= K125), I115 (≠ V129), Y118 (≠ R132)
Q9GZT4 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Homo sapiens (Human) (see 4 papers)
34% identity, 58% coverage: 32:338/531 of query aligns to 18:321/340 of Q9GZT4
- S31 (≠ M45) binding
- S32 (≠ G46) binding
- I33 (≠ K47) binding
- K51 (≠ P65) binding
- T52 (≠ V66) binding
- K56 (= K70) modified: N6-(pyridoxal phosphate)lysine
- P69 (≠ Q83) binding
- T81 (≠ C92) binding
- N86 (= N97) binding
- Q89 (= Q100) binding
- Y121 (≠ R132) binding
- D178 (≠ E189) binding
- G185 (= G196) binding
- G186 (= G197) binding
- G187 (= G198) binding
- G188 (= G199) binding
- M189 (≠ L200) binding
- E210 (= E221) binding ; binding ; binding
- A214 (= A225) binding ; binding ; binding
- D216 (≠ A226) binding ; binding ; binding
- N247 (≠ E258) binding ; binding
- K279 (≠ R290) binding
- S313 (= S330) binding
- N316 (= N333) binding
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
33% identity, 58% coverage: 32:338/531 of query aligns to 16:314/322 of 3l6bA
- active site: K54 (= K70), S77 (≠ A95), E203 (= E221), A207 (= A225), D209 (≠ A226), G232 (= G249), T278 (≠ A296), L305 (= L329), S306 (= S330)
- binding malonate ion: K54 (= K70), S76 (= S94), S77 (≠ A95), N79 (= N97), H80 (= H98), R128 (vs. gap), G232 (= G249)
- binding manganese (ii) ion: E203 (= E221), A207 (= A225), D209 (≠ A226)
- binding pyridoxal-5'-phosphate: F53 (= F69), K54 (= K70), N79 (= N97), G178 (= G196), G179 (= G197), G180 (= G198), G181 (= G199), M182 (≠ L200), V233 (= V250), E276 (= E294), T278 (≠ A296), S306 (= S330), G307 (= G331)
6zspAAA serine racemase bound to atp and malonate. (see paper)
33% identity, 58% coverage: 32:338/531 of query aligns to 15:311/320 of 6zspAAA
- active site: K53 (= K70), S74 (≠ A95), E200 (= E221), A204 (= A225), D206 (≠ A226), G229 (= G249), L302 (= L329), S303 (= S330)
- binding adenosine-5'-triphosphate: S28 (≠ M45), S29 (≠ G46), I30 (≠ K47), K48 (≠ P65), T49 (≠ V66), Q79 (= Q100), Y111 (≠ R132), E266 (= E287), R267 (≠ D288), K269 (≠ R290), N306 (= N333)
- binding magnesium ion: E200 (= E221), A204 (= A225), D206 (≠ A226)
- binding malonate ion: K53 (= K70), S73 (= S94), S74 (≠ A95), N76 (= N97), H77 (= H98), R125 (vs. gap), G229 (= G249), S232 (≠ K253)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
34% identity, 57% coverage: 37:341/531 of query aligns to 24:317/323 of O59791
- K57 (= K70) active site, Proton acceptor; modified: Lysino-D-alanine (Lys); alternate; modified: N6-(pyridoxal phosphate)lysine; alternate
- S82 (≠ A95) active site, Proton acceptor; mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
- N84 (= N97) binding
- G183 (= G196) binding
- G184 (= G197) binding
- G185 (= G198) binding
- G186 (= G199) binding
- L187 (= L200) binding
- E208 (= E221) binding
- G212 (≠ A225) binding
- D214 (≠ C227) binding
- S308 (= S330) binding
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
34% identity, 57% coverage: 37:341/531 of query aligns to 20:313/319 of 2zr8A
- active site: K53 (= K70), S78 (≠ A95), E204 (= E221), G208 (≠ A225), D210 (≠ C227), G232 (= G249), I303 (≠ L329), S304 (= S330)
- binding magnesium ion: E204 (= E221), G208 (≠ A225), D210 (≠ C227)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F69), K53 (= K70), S77 (= S94), S78 (≠ A95), N80 (= N97), H81 (= H98), P147 (= P164), G179 (= G196), G180 (= G197), G181 (= G198), G182 (= G199), G232 (= G249), E277 (= E294), T279 (≠ A296), S304 (= S330)
- binding serine: S78 (≠ A95), R129 (≠ A146), D231 (= D248), G232 (= G249), A233 (≠ V250), Q234 (≠ A251), T235 (≠ V252)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
34% identity, 57% coverage: 37:341/531 of query aligns to 20:313/319 of 2zpuA
- active site: K53 (= K70), S78 (≠ A95), E204 (= E221), G208 (≠ A225), D210 (≠ C227), G232 (= G249), I303 (≠ L329), S304 (= S330)
- binding magnesium ion: E204 (= E221), G208 (≠ A225), D210 (≠ C227)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F69), K53 (= K70), S77 (= S94), S78 (≠ A95), N80 (= N97), H81 (= H98), P147 (= P164), G179 (= G196), G180 (= G197), G181 (= G198), G182 (= G199), G232 (= G249), E277 (= E294), T279 (≠ A296), S304 (= S330)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 57% coverage: 32:335/531 of query aligns to 15:310/310 of 7nbgDDD
- active site: K53 (= K70), S76 (≠ A95), E202 (= E221), A206 (= A225), D208 (≠ A226), G231 (= G249), L304 (= L329), S305 (= S330)
- binding calcium ion: E202 (= E221), A206 (= A225), D208 (≠ A226)
- binding magnesium ion: N239 (≠ E258)
- binding ortho-xylene: S76 (≠ A95), Q81 (= Q100), I96 (= I115), Y113 (≠ R132)
- binding pyridoxal-5'-phosphate: F52 (= F69), K53 (= K70), N78 (= N97), G177 (= G196), G178 (= G197), G179 (= G198), G180 (= G199), M181 (≠ L200), G231 (= G249), V232 (= V250), E275 (= E294), T277 (≠ A296), S305 (= S330), G306 (= G331)
Sites not aligning to the query:
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
34% identity, 57% coverage: 37:341/531 of query aligns to 19:312/318 of 1wtcA
- active site: K52 (= K70), S77 (≠ A95), E203 (= E221), G207 (≠ A225), D209 (≠ C227), G231 (= G249), I302 (≠ L329), S303 (= S330)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ K38), K47 (≠ P65), M48 (≠ V66), A109 (≠ D127), A110 (= A128), Y114 (≠ R132)
- binding magnesium ion: E203 (= E221), G207 (≠ A225), D209 (≠ C227)
- binding pyridoxal-5'-phosphate: F51 (= F69), K52 (= K70), N79 (= N97), G178 (= G196), G179 (= G197), G180 (= G198), G181 (= G199), G231 (= G249), E276 (= E294), T278 (≠ A296), S303 (= S330)
1v71A Crystal structure of s.Pombe serine racemase
34% identity, 57% coverage: 37:341/531 of query aligns to 19:312/318 of 1v71A
- active site: K52 (= K70), S77 (≠ A95), E203 (= E221), G207 (≠ A225), D209 (≠ C227), G231 (= G249), I302 (≠ L329), S303 (= S330)
- binding magnesium ion: E203 (= E221), G207 (≠ A225), D209 (≠ C227)
- binding pyridoxal-5'-phosphate: F51 (= F69), K52 (= K70), N79 (= N97), G178 (= G196), G179 (= G197), G180 (= G198), G181 (= G199), G231 (= G249), E276 (= E294), T278 (≠ A296), S303 (= S330), G304 (= G331)
Query Sequence
>6939184 FitnessBrowser__SB2B:6939184
MLDFSGCGDRDKSEVKPVDLAHYYLQKILLSSVYDVAKVTPLSHMGKLSARLGQEIYLKR
EDMQPVHSFKLRGAYNRISQLTQPECERGVVCASAGNHAQGVALSASSRGIDAVIVMPTT
TPDIKIDAVRRRGGNVLLHGESFDQANAHAQHLAQTEGRVYIAPFDDEAVIAGQGTVAQE
MLQQQRDLELVFVPVGGGGLVAGIAAYYKAVRPSVKIIGVEPEDAACLKAAMAAGEPVTL
SQVGLFADGVAVKRIGAEPFRIAKHYVDEVVTVSSDEICAAVKDIFEDTRAIAEPAGALS
LAGLKKYLAQTTPALAEAGKPARKVAAILSGANVNFHSLRYVSERCELGEQKEAVLAVKV
PEVPGSFLKFCELLGKRAMTEFNYRFSGRDSAVVFAGIRLSGGQSELKEIIASLTSGGFE
VQDLSSDETAKLHVRYMVGGHPTEPLSERLFSFEFPEYPGALLKFLTTLGSRWNISLFHY
RNHGAAFGRVLAGFEVPEGDNEAFGRFLTELGFVWQEETHSPAYRLFLGSK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory