SitesBLAST
Comparing 6939187 Sama_3281 acetolactate synthase 2 catalytic subunit (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
46% identity, 98% coverage: 7:551/556 of query aligns to 95:660/667 of P09342
- C161 (= C72) modified: Disulfide link with 307
- P194 (≠ S105) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V212) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
46% identity, 98% coverage: 7:551/556 of query aligns to 92:657/664 of P09114
- P191 (≠ S105) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W469) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
6lpiB Crystal structure of ahas holo-enzyme (see paper)
47% identity, 97% coverage: 8:549/556 of query aligns to 8:539/539 of 6lpiB
- active site: I27 (≠ Y27), G29 (= G29), G30 (= G30), S31 (≠ A31), I32 (= I32), E53 (= E52), C76 (≠ T75), F115 (= F114), Q116 (= Q115), E117 (= E116), K165 (= K164), M256 (= M255), A283 (≠ V282), V375 (= V380), G401 (= G406), M403 (= M408), D428 (= D433), N455 (= N460), A457 (≠ R462), L458 (= L463), L460 (≠ M465), V461 (= V466), Q464 (≠ W469)
- binding flavin-adenine dinucleotide: R155 (= R154), G212 (= G209), G213 (= G210), G214 (= G211), T236 (= T235), L237 (= L236), M238 (≠ K237), L254 (= L253), M256 (= M255), H257 (= H256), G276 (= G275), A277 (= A276), R278 (= R277), D280 (= D279), R282 (= R281), A283 (≠ V282), D300 (= D299), I301 (= I300), D319 (≠ E318), V320 (≠ L319), M380 (= M385), G398 (≠ A403)
- binding magnesium ion: D428 (= D433), N455 (= N460)
- binding thiamine diphosphate: E53 (= E52), C76 (≠ T75), P79 (= P78), G376 (= G381), Q377 (= Q382), H378 (= H383), G401 (= G406), M403 (= M408), G427 (= G432), D428 (= D433), G429 (= G434), S430 (= S435), M433 (= M438), N455 (= N460), A457 (≠ R462), L458 (= L463), G459 (= G464), L460 (≠ M465), V461 (= V466)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M255), R292 (= R281), W489 (= W469), S568 (≠ P541)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V380), G401 (= G381), Q402 (= Q382), H403 (= H383), G426 (= G406), M428 (= M408), G452 (= G432), D453 (= D433), G454 (= G434), S455 (= S435), L483 (= L463), G484 (= G464), M485 (= M465), V486 (= V466)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), M263 (= M252), L264 (= L253), M266 (= M255), H267 (= H256), G286 (= G275), R288 (= R277), V293 (= V282), D310 (= D299), I311 (= I300), D329 (≠ E318), V330 (≠ L319), M405 (= M385), G423 (≠ A403)
- binding magnesium ion: A37 (= A31), T82 (= T75), S83 (= S76), Q122 (= Q115), Y381 (= Y358), D453 (= D433), M458 (= M438), Q461 (= Q441), N480 (= N460), H482 (≠ R462), K533 (≠ A506)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
45% identity, 99% coverage: 4:551/556 of query aligns to 95:663/670 of P17597
- A122 (= A31) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (= M33) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E52) binding
- S186 (= S94) binding
- P197 (≠ S105) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ S107) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q115) binding
- K220 (= K128) binding
- R246 (= R154) binding ; binding
- K256 (= K164) binding
- G308 (= G210) binding
- TL 331:332 (= TL 235:236) binding
- C340 (≠ H244) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 253:256) binding
- GVRFD 371:375 (≠ GARFD 275:279) binding
- DR 376:377 (= DR 280:281) binding
- DI 395:396 (= DI 299:300) binding
- DV 414:415 (≠ EL 318:319) binding
- QH 487:488 (= QH 382:383) binding
- GG 508:509 (≠ AG 403:404) binding
- GAM 511:513 (≠ GTM 406:408) binding
- D538 (= D433) binding
- DGS 538:540 (= DGS 433:435) binding
- N565 (= N460) binding
- NQHLGM 565:570 (≠ NQRLGM 460:465) binding
- H567 (≠ R462) binding
- W574 (= W469) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P541) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/583 of 5k3sA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (= A31), S38 (≠ I32), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (= K164), M266 (= M255), V293 (= V282), V400 (= V380), G426 (= G406), M428 (= M408), D453 (= D433), N480 (= N460), H482 (≠ R462), L483 (= L463), M485 (= M465), V486 (= V466), W489 (= W469), H558 (≠ D531)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R281), M485 (= M465), W489 (= W469), G569 (= G542)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), L264 (= L253), M266 (= M255), G286 (= G275), R288 (= R277), D290 (= D279), V293 (= V282), D310 (= D299), I311 (= I300), D329 (≠ E318), V330 (≠ L319), M405 (= M385), G423 (≠ A403)
- binding magnesium ion: D453 (= D433), N480 (= N460), H482 (≠ R462)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V380), G401 (= G381), Q402 (= Q382), H403 (= H383), G426 (= G406), M428 (= M408), D453 (= D433), G454 (= G434), S455 (= S435), N480 (= N460), H482 (≠ R462), L483 (= L463), G484 (= G464), M485 (= M465), V486 (= V466)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V380), G401 (= G381), Q402 (= Q382), H403 (= H383), G426 (= G406), M428 (= M408), G452 (= G432), D453 (= D433), G454 (= G434), S455 (= S435), M458 (= M438), N480 (= N460), H482 (≠ R462), L483 (= L463), G484 (= G464), M485 (= M465), V486 (= V466)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), L264 (= L253), M266 (= M255), H267 (= H256), G286 (= G275), V287 (≠ A276), R288 (= R277), D290 (= D279), R292 (= R281), V293 (= V282), D310 (= D299), I311 (= I300), D329 (≠ E318), V330 (≠ L319), M405 (= M385), G423 (≠ A403)
- binding magnesium ion: F370 (≠ Y350), D453 (= D433), M458 (= M438), Q461 (= Q441), N480 (= N460), H482 (≠ R462), K533 (≠ A506)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M255), R292 (= R281), M485 (= M465), W489 (= W469), S568 (≠ P541)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/582 of 5wj1A
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (= A31), S38 (≠ I32), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (= K164), M266 (= M255), V293 (= V282), V400 (= V380), G426 (= G406), M428 (= M408), D453 (= D433), N480 (= N460), H482 (≠ R462), L483 (= L463), M485 (= M465), V486 (= V466), W489 (= W469), H558 (≠ D531)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), M263 (= M252), L264 (= L253), G286 (= G275), R288 (= R277), V293 (= V282), D310 (= D299), I311 (= I300), D329 (≠ E318), V330 (≠ L319), M405 (= M385), G423 (≠ A403), G424 (= G404)
- binding magnesium ion: D453 (= D433), N480 (= N460), H482 (≠ R462)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M255), D291 (= D280), R292 (= R281), M485 (= M465), W489 (= W469), S568 (≠ P541)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V380), G401 (= G381), Q402 (= Q382), H403 (= H383), M428 (= M408), D453 (= D433), G454 (= G434), S455 (= S435), M458 (= M438), N480 (= N460), H482 (≠ R462), L483 (= L463), G484 (= G464), M485 (= M465), V486 (= V466)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/582 of 5k6tA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (= A31), S38 (≠ I32), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (= K164), M266 (= M255), V293 (= V282), V400 (= V380), G426 (= G406), M428 (= M408), D453 (= D433), N480 (= N460), H482 (≠ R462), L483 (= L463), M485 (= M465), V486 (= V466), W489 (= W469), H558 (≠ D531)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H256), R292 (= R281), M485 (= M465), W489 (= W469), S568 (≠ P541)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), L264 (= L253), G286 (= G275), R288 (= R277), D290 (= D279), R292 (= R281), V293 (= V282), D310 (= D299), I311 (= I300), D329 (≠ E318), V330 (≠ L319), Q404 (= Q384), M405 (= M385), G423 (≠ A403)
- binding magnesium ion: D453 (= D433), N480 (= N460), H482 (≠ R462)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V380), G401 (= G381), Q402 (= Q382), H403 (= H383), G426 (= G406), M428 (= M408), G452 (= G432), G454 (= G434), S455 (= S435), N480 (= N460), H482 (≠ R462), L483 (= L463), G484 (= G464)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/582 of 5k6rA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (= A31), S38 (≠ I32), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (= K164), M266 (= M255), V293 (= V282), V400 (= V380), G426 (= G406), M428 (= M408), D453 (= D433), N480 (= N460), H482 (≠ R462), L483 (= L463), M485 (= M465), V486 (= V466), W489 (= W469), H558 (≠ D531)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R281), W489 (= W469), S568 (≠ P541)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), L264 (= L253), M266 (= M255), G286 (= G275), R288 (= R277), R292 (= R281), V293 (= V282), D310 (= D299), I311 (= I300), G328 (≠ A317), D329 (≠ E318), V330 (≠ L319), M405 (= M385), G423 (≠ A403)
- binding magnesium ion: D453 (= D433), N480 (= N460), H482 (≠ R462)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V380), G401 (= G381), Q402 (= Q382), H403 (= H383), G426 (= G406), M428 (= M408), D453 (= D433), G454 (= G434), S455 (= S435), M458 (= M438), N480 (= N460), H482 (≠ R462), L483 (= L463), G484 (= G464), M485 (= M465), V486 (= V466)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/582 of 1z8nA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (= A31), S38 (≠ I32), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (= K164), M266 (= M255), V293 (= V282), V400 (= V380), G426 (= G406), M428 (= M408), D453 (= D433), N480 (= N460), H482 (≠ R462), L483 (= L463), M485 (= M465), V486 (= V466), W489 (= W469), H558 (≠ D531)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K128), R161 (= R154), Y191 (≠ L178), R194 (≠ A181), D291 (= D280), R292 (= R281), D312 (= D301), W489 (= W469), G569 (= G542)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G209), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), L264 (= L253), G265 (= G254), M266 (= M255), H267 (= H256), G286 (= G275), V287 (≠ A276), R288 (= R277), D290 (= D279), R292 (= R281), V293 (= V282), D310 (= D299), I311 (= I300), D329 (≠ E318), V330 (≠ L319), M405 (= M385), G423 (≠ A403), G424 (= G404)
- binding magnesium ion: D453 (= D433), N480 (= N460)
- binding thiamine diphosphate: V400 (= V380), G401 (= G381), Q402 (= Q382), H403 (= H383), G426 (= G406), M428 (= M408), G452 (= G432), G454 (= G434), S455 (= S435), N480 (= N460), H482 (≠ R462), L483 (= L463), G484 (= G464), M485 (= M465), V486 (= V466)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/582 of 1yi1A
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (= A31), S38 (≠ I32), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (= K164), M266 (= M255), V293 (= V282), V400 (= V380), G426 (= G406), M428 (= M408), D453 (= D433), N480 (= N460), H482 (≠ R462), L483 (= L463), M485 (= M465), V486 (= V466), W489 (= W469), H558 (≠ D531)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D280), R292 (= R281), W489 (= W469), S568 (≠ P541)
- binding flavin-adenine dinucleotide: R161 (= R154), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), M263 (= M252), L264 (= L253), G265 (= G254), M266 (= M255), H267 (= H256), G286 (= G275), V287 (≠ A276), R288 (= R277), D290 (= D279), V293 (= V282), D310 (= D299), I311 (= I300), D329 (≠ E318), V330 (≠ L319), M405 (= M385), G423 (≠ A403), G424 (= G404)
- binding magnesium ion: D453 (= D433), N480 (= N460), H482 (≠ R462)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/582 of 1yi0A
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (= A31), S38 (≠ I32), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (= K164), M266 (= M255), V293 (= V282), V400 (= V380), G426 (= G406), M428 (= M408), D453 (= D433), N480 (= N460), H482 (≠ R462), L483 (= L463), M485 (= M465), V486 (= V466), W489 (= W469), H558 (≠ D531)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D280), R292 (= R281), W489 (= W469), S568 (≠ P541)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), L264 (= L253), G265 (= G254), M266 (= M255), H267 (= H256), G286 (= G275), V287 (≠ A276), R288 (= R277), D290 (= D279), R292 (= R281), V293 (= V282), D310 (= D299), I311 (= I300), G328 (≠ A317), D329 (≠ E318), V330 (≠ L319), M405 (= M385), G423 (≠ A403), G424 (= G404)
- binding magnesium ion: D453 (= D433), N480 (= N460), H482 (≠ R462)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/582 of 1yhzA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (= A31), S38 (≠ I32), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (= K164), M266 (= M255), V293 (= V282), V400 (= V380), G426 (= G406), M428 (= M408), D453 (= D433), N480 (= N460), H482 (≠ R462), L483 (= L463), M485 (= M465), V486 (= V466), W489 (= W469), H558 (≠ D531)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D280), R292 (= R281), M485 (= M465), W489 (= W469), S568 (≠ P541)
- binding flavin-adenine dinucleotide: R161 (= R154), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), L264 (= L253), M266 (= M255), H267 (= H256), G286 (= G275), V287 (≠ A276), R288 (= R277), D290 (= D279), V293 (= V282), D310 (= D299), I311 (= I300), D329 (≠ E318), V330 (≠ L319), Q404 (= Q384), M405 (= M385), G423 (≠ A403), G424 (= G404)
- binding magnesium ion: D453 (= D433), N480 (= N460), H482 (≠ R462)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/582 of 1yhyA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (= A31), S38 (≠ I32), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (= K164), M266 (= M255), V293 (= V282), V400 (= V380), G426 (= G406), M428 (= M408), D453 (= D433), N480 (= N460), H482 (≠ R462), L483 (= L463), M485 (= M465), V486 (= V466), W489 (= W469), H558 (≠ D531)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D280), R292 (= R281), V486 (= V466), W489 (= W469), S568 (≠ P541)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), L264 (= L253), G265 (= G254), M266 (= M255), H267 (= H256), G286 (= G275), V287 (≠ A276), R288 (= R277), D290 (= D279), V293 (= V282), D310 (= D299), I311 (= I300), D329 (≠ E318), V330 (≠ L319), Q404 (= Q384), M405 (= M385), G423 (≠ A403), G424 (= G404)
- binding magnesium ion: D453 (= D433), N480 (= N460), H482 (≠ R462)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/582 of 1ybhA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (= A31), S38 (≠ I32), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (= K164), M266 (= M255), V293 (= V282), V400 (= V380), G426 (= G406), M428 (= M408), D453 (= D433), N480 (= N460), H482 (≠ R462), L483 (= L463), M485 (= M465), V486 (= V466), W489 (= W469), H558 (≠ D531)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M255), D291 (= D280), R292 (= R281), M485 (= M465), W489 (= W469), S568 (≠ P541)
- binding flavin-adenine dinucleotide: R161 (= R154), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), L264 (= L253), M266 (= M255), H267 (= H256), G286 (= G275), V287 (≠ A276), R288 (= R277), D290 (= D279), V293 (= V282), D310 (= D299), I311 (= I300), D329 (≠ E318), V330 (≠ L319), Q404 (= Q384), M405 (= M385), G423 (≠ A403), G424 (= G404)
- binding magnesium ion: D453 (= D433), N480 (= N460), H482 (≠ R462)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 10:578/585 of 5k2oA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (= A31), S38 (≠ I32), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (= K164), M266 (= M255), V293 (= V282), V400 (= V380), G426 (= G406), M428 (= M408), D453 (= D433), N480 (= N460), H482 (≠ R462), L483 (= L463), M485 (= M465), V486 (= V466), W489 (= W469), H558 (≠ D531)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M255), R292 (= R281), W489 (= W469), S568 (≠ P541)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T235), L247 (= L236), M248 (≠ K237), L264 (= L253), G286 (= G275), R288 (= R277), D290 (= D279), V293 (= V282), D310 (= D299), I311 (= I300), D329 (≠ E318), V330 (≠ L319), Q404 (= Q384), M405 (= M385), G423 (≠ A403)
- binding magnesium ion: D453 (= D433), N480 (= N460), H482 (≠ R462)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V380), G401 (= G381), Q402 (= Q382), H403 (= H383), M428 (= M408), D453 (= D433), G454 (= G434), S455 (= S435), N480 (= N460), H482 (≠ R462), L483 (= L463), G484 (= G464), M485 (= M465), V486 (= V466)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 9:577/582 of 3ea4A
- active site: Y32 (= Y27), G34 (= G29), G35 (= G30), A36 (= A31), S37 (≠ I32), E58 (= E52), T81 (= T75), F120 (= F114), Q121 (= Q115), E122 (= E116), K170 (= K164), M265 (= M255), V292 (= V282), V399 (= V380), G425 (= G406), M427 (= M408), D452 (= D433), N479 (= N460), H481 (≠ R462), L482 (= L463), M484 (= M465), V485 (= V466), W488 (= W469), H557 (≠ D531)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D280), R291 (= R281), W488 (= W469), S567 (≠ P541)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R154), G221 (= G209), G222 (= G210), G223 (= G211), T245 (= T235), L246 (= L236), M247 (≠ K237), L263 (= L253), G264 (= G254), M265 (= M255), H266 (= H256), G285 (= G275), R287 (= R277), D289 (= D279), R291 (= R281), D309 (= D299), I310 (= I300), G327 (≠ A317), D328 (≠ E318), V329 (≠ L319), M404 (= M385), G422 (≠ A403)
- binding magnesium ion: D452 (= D433), N479 (= N460), H481 (≠ R462)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V380), G400 (= G381), Q401 (= Q382), H402 (= H383), M427 (= M408), G451 (= G432), D452 (= D433), G453 (= G434), S454 (= S435), N479 (= N460), H481 (≠ R462), L482 (= L463), G483 (= G464), M484 (= M465), V485 (= V466)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
45% identity, 99% coverage: 4:551/556 of query aligns to 9:577/582 of 3e9yA
- active site: Y32 (= Y27), G34 (= G29), G35 (= G30), A36 (= A31), S37 (≠ I32), E58 (= E52), T81 (= T75), F120 (= F114), Q121 (= Q115), E122 (= E116), K170 (= K164), M265 (= M255), V292 (= V282), V399 (= V380), G425 (= G406), M427 (= M408), D452 (= D433), N479 (= N460), H481 (≠ R462), L482 (= L463), M484 (= M465), V485 (= V466), W488 (= W469), H557 (≠ D531)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D280), R291 (= R281), W488 (= W469), S567 (≠ P541)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R154), G221 (= G209), G222 (= G210), G223 (= G211), T245 (= T235), L246 (= L236), M247 (≠ K237), L263 (= L253), G285 (= G275), R287 (= R277), D289 (= D279), R291 (= R281), D309 (= D299), I310 (= I300), G327 (≠ A317), D328 (≠ E318), V329 (≠ L319), M404 (= M385), G422 (≠ A403)
- binding magnesium ion: D452 (= D433), N479 (= N460), H481 (≠ R462)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V380), G400 (= G381), Q401 (= Q382), H402 (= H383), M427 (= M408), G451 (= G432), G453 (= G434), S454 (= S435), N479 (= N460), H481 (≠ R462), L482 (= L463), G483 (= G464), M484 (= M465), V485 (= V466)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
43% identity, 99% coverage: 6:554/556 of query aligns to 8:582/596 of 1t9cA
- active site: Y29 (= Y27), G31 (= G29), G32 (= G30), A33 (= A31), I34 (= I32), E55 (= E52), T78 (= T75), F117 (= F114), Q118 (= Q115), E119 (= E116), K167 (= K164), R227 (≠ E219), M263 (= M255), V290 (= V282), V406 (= V380), L431 (= L405), G432 (= G406), M434 (= M408), D459 (= D433), N486 (= N460), E488 (≠ R462), Q489 (≠ L463), M491 (= M465), V492 (= V466), W495 (= W469), L517 (= L492), G522 (≠ D497), L523 (≠ I498), K556 (≠ D531)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G30), V107 (= V104), P108 (≠ S105), F117 (= F114), K167 (= K164), D288 (= D280), R289 (= R281), W495 (= W469)
- binding flavin-adenine dinucleotide: R157 (= R154), G216 (= G209), A217 (≠ G210), G218 (= G211), N221 (≠ G213), T243 (= T235), L244 (= L236), Q245 (≠ K237), L261 (= L253), M263 (= M255), H264 (= H256), G283 (= G275), A284 (= A276), R285 (= R277), D287 (= D279), R289 (= R281), V290 (= V282), E316 (≠ D299), V317 (≠ I300), N321 (≠ E304), G334 (≠ A317), D335 (≠ E318), A336 (≠ L319), M411 (= M385), G429 (≠ A403), G430 (= G404)
- binding magnesium ion: D459 (= D433), N486 (= N460), E488 (≠ R462)
Query Sequence
>6939187 Sama_3281 acetolactate synthase 2 catalytic subunit (RefSeq)
MEGQTMRGADAVIKVLAAHGVNTVFGYPGGAIMPIYDALYGSEVEHTLCRHEQGAGFAAV
GYARASGKTGVCFATSGPGATNLITALADALLDSVPVVAITGQVSTSVIGTDAFQEIDVL
GMSLSCTKHSFMVQTVDELVPTLYRAFELAASGRPGPVLVDIPKDIQIAKLEYRAPLLAV
ADEPKVQDADIDAARALIAAAKKPMLYVGGGVGMAGAVEPLRHFIKATYMPSVATLKGLG
AIPHGTPGYLGMLGMHGGKAANLAVQECDLLMVVGARFDDRVTGRLASFAPNAKVLHLDI
DAAELGKLRQPDVAIAAELRVVLPMLEMQLDIDPWRAEVEALAAEHRWDYNHPGSLIYAP
AMLRRLANKLPEDSVVSCDVGQHQMWVAQHMHFRRPEDHLSSAGLGTMGFGLPAAIGAQM
ARPDATVVAVSGDGSFMMNVQELTTIKRRKLPVKILLIDNQRLGMVKQWQQLFFEERYSE
TNLSDNPDFVALASAFDIPGRTIFAAEEVEEALTEMLTSKGPYLLHVAIDDAFNVWPLVP
PGASNSDMMEEMERST
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory