Comparing 6939240 Sama_3334 ornithine decarboxylase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
1ordA Crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution (see paper)
58% identity, 99% coverage: 2:717/720 of query aligns to 2:716/730 of 1ordA
1c4kA Ornithine decarboxylase mutant (gly121tyr) (see paper)
58% identity, 99% coverage: 2:717/720 of query aligns to 2:714/728 of 1c4kA
6q6iA Lysine decarboxylase a from pseudomonas aeruginosa
35% identity, 91% coverage: 57:710/720 of query aligns to 91:741/749 of 6q6iA
2vycA Crystal structure of acid induced arginine decarboxylase from e. Coli (see paper)
31% identity, 91% coverage: 47:701/720 of query aligns to 75:741/755 of 2vycA
P28629 Biodegradative arginine decarboxylase; ADC; EC 4.1.1.19 from Escherichia coli (strain K12) (see paper)
31% identity, 91% coverage: 47:701/720 of query aligns to 75:741/755 of P28629
6q7lA Inducible lysine decarboxylase (see paper)
34% identity, 93% coverage: 44:710/720 of query aligns to 63:703/711 of 6q7lA
3n75A X-ray crystal structure of the escherichia coli inducible lysine decarboxylase ldci (see paper)
34% identity, 93% coverage: 44:710/720 of query aligns to 63:703/711 of 3n75A
5xx1G Crystal structure of arginine decarboxylase (adia) from salmonella typhimurium (see paper)
30% identity, 91% coverage: 47:701/720 of query aligns to 76:721/735 of 5xx1G
>6939240 Sama_3334 ornithine decarboxylase (RefSeq)
MNSLKIAASLSVRACFDTKREVVNVLTTDFCDVGAAVVSVTDVNNGIVDKIKNTGLNLPI
FVSVCCEEAFPDDFCDTITGVFELCNAKTDFYGKQVETAVRRYQESLLPPFFGTLKKYVE
MGNSTFACPGHQGGQFFRKHPVGRQFFDFFGETVFRSDMCNADVKLGDLLIHEGAPHDAQ
AYAAKVYNADKTYFVLNGTSASNKVVCNALLAPGDLVLFDRNNHKSNHHGALIQAGATPV
YLETARNPFGFIGGIDSHCFDEAYLRDEIGKVAPERVQAARPFRLAIIQLGTYDGTIYNA
RQVVDRIGHLCDYILFDSAWVGYEQFIPMMKDCSPLLLELGAEDPGIIVTQSVHKQQAGF
SQTSQIHKKDSHIKGQERYCNHKRFNNAFMMHASTSPFYPLFAALDVNAKMHEGASGRYL
WREAVKAGIEARKLLLKKCKYIKPFIPTTVEGEPWQSFDTERMADDLRFFEFEPGLKWHA
FDGYEKGQYFVDPCKFLLTTPGINAETGEYEDFGIPATILANFLRENNIIPEKCDLNSIL
FLMTPAEDMAKMQHLVTQIARFEKLIDEDAPLSEVLPNVYRTNRERYEGYSIRRLCQEMH
DLYVSRNVKQLQKEMFRAAHFPKAVMNPQDANIAFVRGKAELVPLSEIEGQIAAEGALPY
PPGVLCMVPGEVWGGAVQRYFLALEEGINLLPGFAPELQGVYLERADNGRVQAMGYVLKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory