SitesBLAST
Comparing 6939346 FitnessBrowser__SB2B:6939346 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
29% identity, 92% coverage: 53:744/750 of query aligns to 18:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M73), G39 (= G74), Q40 (= Q75), H41 (≠ G76), V42 (≠ I77), A45 (≠ G80), G79 (≠ D113), G80 (= G114), S81 (= S115), S83 (= S117), V84 (≠ I118), G374 (= G406), F375 (= F407), L379 (≠ S411), L499 (= L521), R500 (= R522), V624 (= V650), D625 (≠ N651), Q632 (= Q658), T687 (≠ G713), G688 (= G714), L689 (≠ V715), G690 (= G716), E691 (= E717)
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
27% identity, 33% coverage: 195:438/750 of query aligns to 5:270/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
27% identity, 33% coverage: 195:438/750 of query aligns to 4:269/420 of 3hrdE
Sites not aligning to the query:
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
27% identity, 33% coverage: 195:438/750 of query aligns to 4:269/420 of 3hrdA
Sites not aligning to the query:
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 44% coverage: 213:543/750 of query aligns to 22:365/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
26% identity, 34% coverage: 181:438/750 of query aligns to 5:277/769 of O33819
Sites not aligning to the query:
- 522:526 binding
- 650:655 binding
- 722:725 binding
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
26% identity, 31% coverage: 204:438/750 of query aligns to 9:269/761 of 1rm6A
Sites not aligning to the query:
- active site: 318, 322, 350, 718, 719
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 350, 473, 474, 475, 476, 513, 514, 515, 517, 518, 646, 647, 651, 654, 714, 715, 716, 717, 718
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
30% identity, 16% coverage: 626:744/750 of query aligns to 191:316/330 of 3hrdB
- active site: E289 (= E717), P290 (= P718)
- binding pterin cytosine dinucleotide: I215 (≠ V650), N216 (= N651), M219 (≠ R654), V220 (= V655), Q223 (= Q658), K285 (vs. gap), G286 (= G714), V287 (= V715), G288 (= G716), E289 (= E717)
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
30% identity, 16% coverage: 626:744/750 of query aligns to 191:316/330 of Q0QLF1
- 211:223 (vs. 646:658, 38% identical) binding
- AKGVGE 284:289 (≠ --GVGE 714:717) binding
Sites not aligning to the query:
- 45:49 binding
- 85:90 binding
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
32% identity, 16% coverage: 628:744/750 of query aligns to 571:695/701 of 4zohA
Sites not aligning to the query:
- active site: 186, 219, 298, 300, 304, 332
- binding pterin cytosine dinucleotide: 213, 214, 215, 332, 442, 443, 444, 446, 482, 484, 486, 487
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
25% identity, 29% coverage: 239:452/750 of query aligns to 586:817/1291 of 6a7xB
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 880, 881, 885, 886, 889
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 851, 885, 980, 981, 1049, 1050, 1232
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
25% identity, 29% coverage: 239:452/750 of query aligns to 588:819/1291 of 2e3tA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 882, 883, 887, 888, 891
- binding calcium ion: 840, 843, 844, 847, 880, 881
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 853, 887, 982, 983, 1051, 1052, 1234
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
25% identity, 29% coverage: 239:452/750 of query aligns to 586:817/1286 of 4yswA
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 848, 880, 881, 882, 885, 886, 889
- binding calcium ion: 838, 841, 842, 845, 878, 879
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 851, 885, 980, 981, 1050, 1232
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
25% identity, 29% coverage: 239:452/750 of query aligns to 588:819/1295 of 6a7xA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 883, 884, 887, 888, 891
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 853, 887, 982, 983, 1052, 1234
2ckjA Human milk xanthine oxidoreductase
35% identity, 15% coverage: 370:480/750 of query aligns to 705:816/1264 of 2ckjA
Sites not aligning to the query:
- active site: 824, 828, 856, 1204, 1205
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234, 308, 309, 317, 318, 321, 322, 324, 325, 331, 375
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 29% coverage: 239:452/750 of query aligns to 615:846/1331 of P22985
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 256:263 binding
- 335:336 WF→AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 346:350 binding
- 359 binding
- 403 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
35% identity, 15% coverage: 370:480/750 of query aligns to 762:873/1333 of P47989
- L763 (= L371) to F: in a breast cancer sample; somatic mutation
- R791 (≠ N399) to G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 257:264 binding
- 337 binding
- 347:351 binding
- 360 binding
- 395 K → M: in dbSNP:rs34929837
- 422 binding
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 584 D → A: in dbSNP:rs45491693
- 607 R → Q: in dbSNP:rs45442092
- 617 K → N: in dbSNP:rs45442398
- 623 T → I: in dbSNP:rs45448694
- 646 I → V: in dbSNP:rs17323225
- 703 I → V: in dbSNP:rs17011368
- 910 T → M: in dbSNP:rs669884
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
Q7G9P4 Abscisic-aldehyde oxidase; Aldehyde oxidase 3; AO-3; AtAO-3; AtAO4; Indole-3-acetaldehyde oxidase; IAA oxidase; EC 1.2.3.14; EC 1.2.3.7 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 15% coverage: 337:452/750 of query aligns to 729:848/1332 of Q7G9P4
- LQRPVK 821:826 (≠ INKPVL 426:431) mutation to WDLDQ: In aao3-3; wilty phenotype in rosette leaves, reduced ABA levels, reduced dormancy, abnormal water loss and abnormal response to water deficit.
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
35% identity, 15% coverage: 370:480/750 of query aligns to 736:847/1307 of 2e1qA
Sites not aligning to the query:
- active site: 855, 859, 887, 1235, 1236
- binding bicarbonate ion: 852, 886, 889, 890, 893
- binding calcium ion: 715, 716, 718
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 719
- binding hydroxy(dioxo)molybdenum: 887, 1053, 1054, 1236
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
27% identity, 37% coverage: 193:466/750 of query aligns to 13:302/731 of 5g5gC
Sites not aligning to the query:
- active site: 316, 322, 350, 692, 693
- binding pterin cytosine dinucleotide: 350, 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
Query Sequence
>6939346 FitnessBrowser__SB2B:6939346
MSKFTAIENFSRRDVLKLFGASGGALMLGASGLGWSPMLAAQTAAFGDEQRLNLFIAIGE
DNRVYLTCHRSEMGQGIRTGIVQVLADELEADWDKVVVVQGLADKRYGSQNTDGSRSIRK
GFDKMREMGAMARHMLEQAAAESWQVPVSEVYAKAHAVHHKGSDKRLSYGELAMAAAKLP
MPDAKTLTLKTPDKFTQIGKGHTIVDMDDMLGGRAIYGADNRPEGLVYAVIARPPVFGSQ
LESLDDSAARKVAGVLDIVTLPVPKGAPAFQPLGGVAVVASNTWSALEGRKALKLSWSKS
ANDTHNSKAYLDTLKQRVQEPGKVARELGSQPASWPEDKMVSATYTVPYLAHAPMEPPAV
IASVDKNGCELWASSQTPQSTQQNVAGMLGIDEDKVKVNVTLLGGGFGRKSKPDFSVEAA
FISSKINKPVLVQWSREDELRNGYLHAISAQYYQACIDEKGKVQAMLSRTAFPSIGSTFD
SAVDTPQPFELDLGFTDIPWDINAVRCEAVKAETHTRIGWLRSVSNIQHGFGVGSFVDEL
AIANGKSCTAQWRELLGKARVENFANQGFEYGNYGEEQSRHPVDVGRYLKLIDRAEALTA
QKPAGKNEGWGFAIHRSFVAYAAVAIKVRLEGDKLTVVDAIALMDAGTVVNPDRVAAQME
GAVVFGLSLALFGEIDFDQGAVTQSNFHDYPLLRLPHCPPIATEIIASSAVPGGVGEPGV
PPVAPALTNAIVAAGGKRYRELPLSKHLKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory