SitesBLAST
Comparing 6939533 FitnessBrowser__SB2B:6939533 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w7uA Escherichia coli k12 ygjk complexed with galactose (see paper)
37% identity, 92% coverage: 42:700/717 of query aligns to 32:757/760 of 3w7uA
3w7tA Escherichia coli k12 ygjk complexed with mannose (see paper)
37% identity, 92% coverage: 42:700/717 of query aligns to 32:757/760 of 3w7tA
- binding beta-D-mannopyranose: W77 (≠ G86), V134 (≠ E148), K215 (≠ R229), P308 (= P309), F315 (= F316), W321 (= W320), W321 (= W320), W323 (= W322), D324 (= D323), D368 (= D367), K391 (= K390), K391 (= K390), W496 (= W464), G499 (= G467), W744 (= W687)
- binding calcium ion: D431 (= D430), N433 (= N432), N435 (= N434), V437 (≠ L436), E439 (= E438), E549 (= E500)
3w7sA Escherichia coli k12 ygjk complexed with glucose (see paper)
37% identity, 92% coverage: 42:700/717 of query aligns to 32:757/760 of 3w7sA
- binding calcium ion: D431 (= D430), N433 (= N432), N435 (= N434), V437 (≠ L436), E439 (= E438), E549 (= E500)
- binding alpha-D-glucopyranose: Y90 (≠ Q100), V97 (≠ F107), K99 (≠ R109), W321 (= W320), D338 (≠ L337), K341 (= K340), S349 (≠ D348), W350 (≠ Y349), Q351 (= Q350), I352 (≠ F351), Q353 (≠ G352), D356 (= D355), D368 (= D367), R378 (= R377), N384 (= N383), N386 (= N385), K391 (= K390), W496 (= W464), W496 (= W464), D501 (= D469)
Sites not aligning to the query:
5gw7B Crystal structure of the glycosynthase mutant e727a of escherichia coli gh63 glycosidase in complex with glucose and lactose (see paper)
37% identity, 92% coverage: 42:700/717 of query aligns to 32:757/760 of 5gw7B
- binding beta-D-glucopyranose: P308 (= P309), F315 (= F316), W321 (= W320), W323 (= W322), D324 (= D323), G499 (= G467), Y679 (= Y622), W685 (= W628), F742 (= F685), W744 (= W687)
- binding calcium ion: D431 (= D430), N433 (= N432), N435 (= N434), V437 (≠ L436), E439 (= E438), E549 (= E500)
- binding beta-D-galactopyranose: W321 (= W320), D368 (= D367), N386 (= N385), K391 (= K390), W496 (= W464), D501 (= D469)
- binding magnesium ion: D538 (= D489), T540 (≠ R491)
6xuxA Crystal structure of megabody mb-nb207-cygjk_no (see paper)
38% identity, 57% coverage: 42:447/717 of query aligns to 340:756/879 of 6xuxA
Sites not aligning to the query:
4wvbA Crystal structure of gh63 mannosylglycerate hydrolase from thermus thermophilus hb8 in complex with glucose (see paper)
29% identity, 52% coverage: 320:694/717 of query aligns to 30:391/394 of 4wvbA
4wvcA Crystal structure of gh63 mannosylglycerate hydrolase from thermus thermophilus hb8 in complex with tris and d-glycerate (see paper)
28% identity, 52% coverage: 320:694/717 of query aligns to 30:410/413 of 4wvcA
6g3nA Mycobacterial hydrolase complex 14.
23% identity, 52% coverage: 319:693/717 of query aligns to 38:441/445 of 6g3nA
Q9W2M2 Trehalase; Alpha,alpha-trehalase; Alpha,alpha-trehalose glucohydrolase; EC 3.2.1.28 from Drosophila melanogaster (Fruit fly) (see paper)
25% identity, 34% coverage: 459:700/717 of query aligns to 334:574/596 of Q9W2M2
- N451 (≠ T584) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5n6nC Crystal structure of the 14-3-3:neutral trehalase nth1 complex (see paper)
25% identity, 23% coverage: 491:654/717 of query aligns to 429:603/698 of 5n6nC
Sites not aligning to the query:
- binding calcium ion: 72, 74, 76, 78, 83
- binding beta-D-fructofuranose: 216, 217, 261, 297, 298, 300, 351, 425
- binding alpha-D-glucopyranose: 188, 257, 267, 268, 298, 423, 425, 655
P32356 Cytosolic neutral trehalase; Alpha,alpha-trehalase; Alpha,alpha-trehalose glucohydrolase; EC 3.2.1.28 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
23% identity, 31% coverage: 432:654/717 of query aligns to 441:656/751 of P32356
- R473 (≠ W464) binding
- S475 (= S466) mutation to A: Abolishes activity; when associated with A-20; A-21; A-58; A-60; A-83; A-135; A-149 and A-260.
- G476 (= G467) binding
- D478 (= D469) mutation to A: Abolishes catalytic activity.
Sites not aligning to the query:
- 20 modified: Phosphoserine; by PKA; S→A: Abolishes activity; when associated with A-21; A-58; A-60; A-83; A-135; A-149; A-260 and A-475. Abolishes activation by BMH1 and BMH2; when associated with A-21; A-60 and A-83.
- 21 modified: Phosphoserine; by PKA; S→A: Abolishes activity; when associated with A-20; A-58; A-60; A-83; A-135; A-149; A-260 and A-475. Abolishes activation by BMH1 and BMH2; when associated with A-20; A-60 and A-83.
- 55 BMH1 binding
- 58 T→A: Abolishes activity; when associated with A-20; A-21; A-60; A-83; A-135; A-149; A-260 and A-475.
- 60 modified: Phosphoserine; by PKA; S→A: Abolishes activity; when associated with A-20; A-21; A-58; A-83; A-135; A-149; A-260 and A-475. Abolishes activation by BMH1 and BMH2; when associated with A-20; A-21 and A-83.
- 83 modified: Phosphoserine; by PKA; S→A: Abolishes activity; when associated with A-20; A-21; A-58; A-60; A-135; A-149; A-260 and A-475. Abolishes activation by BMH1 and BMH2; when associated with A-20; A-21 and A-60.
- 114 binding
- 116 binding
- 118 binding
- 120 binding ; Q→A: Decreases catalytic activity.
- 125 binding
- 135 T→A: Abolishes activity; when associated with A-20; A-21; A-58; A-60; A-83; A-149; A-260 and A-475.
- 149 T→A: Abolishes activity; when associated with A-20; A-21; A-58; A-60; A-83; A-135; A-260 and A-475.
- 260 T→A: Abolishes activity; when associated with A-20; A-21; A-58; A-60; A-83; A-135; A-149 and A-475.
- 309:310 binding
- 346 binding
- 355:357 binding
- 424 binding
- 674 E→A: Abolishes catalytic activity.
- 686 R→A: Decreases catalytic activity.
- 690 E→A: Severely decreases catalytic activity.
- 691 Y→A: Abolishes catalytic activity.
8euxA Chaetomium alpha glucosidase (see paper)
23% identity, 27% coverage: 502:694/717 of query aligns to 553:760/765 of 8euxA
Sites not aligning to the query:
- binding (2R,3R,4R,5S)-2-(hydroxymethyl)-1-{5-[4-(2-methoxyethyl)phenyl]pentyl}piperidine-3,4,5-triol: 381, 382, 386, 388, 389, 536, 538
8eurA Chaetomium alpha glucosidase (see paper)
23% identity, 27% coverage: 502:694/717 of query aligns to 553:760/765 of 8eurA
Sites not aligning to the query:
- binding 2-{[2-nitro-4-(triazan-1-yl)phenyl]amino}ethyl (2-{[(1S,2S,3R,4S,5S)-2,3,4,5-tetrahydroxy-5-(hydroxymethyl)cyclohexyl]amino}ethyl)carbamate: 377, 386, 388, 389, 440, 536, 538
8eudA Chaetomium alpha glucosidase (see paper)
23% identity, 27% coverage: 502:694/717 of query aligns to 553:760/765 of 8eudA
Sites not aligning to the query:
- binding (2R,3R,4R,5S)-2-(hydroxymethyl)-1-{6-[2-methyl-5-(pyrimidin-2-yl)-1H-benzimidazol-1-yl]hexyl}piperidine-3,4,5-triol: 381, 382, 386, 388, 389, 536, 538
8etoA Chaetomium alpha glucosidase (see paper)
23% identity, 27% coverage: 502:694/717 of query aligns to 553:760/765 of 8etoA
Sites not aligning to the query:
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-{[(5Z)-6-{[2-nitro-4-(2H-1,2,3-triazol-2-yl)phenyl]amino}hex-5-en-1-yl]amino}cyclohexane-1,2,3,4-tetrol: 377, 386, 388, 389, 437, 440, 536, 538
8etlA Chaetomium alpha glucosidase (see paper)
23% identity, 27% coverage: 502:694/717 of query aligns to 553:760/765 of 8etlA
Sites not aligning to the query:
- binding (1S,2S,3R,4S,5S)-5-(butylamino)-1-(hydroxymethyl)cyclohexane-1,2,3,4-tetrol: 377, 386, 388, 389, 538
8er4A Chaetomium alpha glucosidase (see paper)
23% identity, 27% coverage: 502:694/717 of query aligns to 553:760/765 of 8er4A
Sites not aligning to the query:
- binding (2R,3R,4R,5S)-1-(2-{6-[2-(4-azido-2-nitroanilino)ethyl]pyrazin-2-yl}ethyl)-2-(hydroxymethyl)piperidine-3,4,5-triol: 377, 382, 386, 388, 389, 536, 538, 539
8eqxA Chaetomium alpha glucosidase (see paper)
23% identity, 27% coverage: 502:694/717 of query aligns to 553:760/765 of 8eqxA
Sites not aligning to the query:
- binding (2R,3R,4R,5S)-2-(hydroxymethyl)-1-{[6-({[(5M)-3-methyl-5-(1H-pyrrol-2-yl)phenyl]amino}methyl)pyridin-2-yl]methyl}piperidine-3,4,5-triol: 381, 382, 386, 388, 389, 536, 538
8eq7A Chaetomium alpha glucosidase (see paper)
23% identity, 27% coverage: 502:694/717 of query aligns to 553:760/765 of 8eq7A
Sites not aligning to the query:
- binding (2R,3R,4R,5S)-1-[(3-{[3-bromo-5-(methanesulfonyl)anilino]methyl}phenyl)methyl]-2-(hydroxymethyl)piperidine-3,4,5-triol: 377, 382, 386, 388, 389, 531, 536, 538, 539
8epoA Chaetomium alpha glucosidase (see paper)
23% identity, 27% coverage: 502:694/717 of query aligns to 553:760/765 of 8epoA
Sites not aligning to the query:
- binding (3P)-3-(5,6-dihydro-1,4-dioxin-2-yl)-5-{[(3-{[(2R,3R,4R,5S)-3,4,5-trihydroxy-2-(hydroxymethyl)piperidin-1-yl]methyl}phenyl)methyl]amino}benzonitrile: 377, 382, 386, 388, 389, 536, 538
Query Sequence
>6939533 FitnessBrowser__SB2B:6939533
MYSCLLLCALGLPGGDLLPYQGVPDSAESRDARGNLSIPAVYTDRGAWHGFHLPDERHAG
SFPGPLIIAQEYSLHLSAAMEAVSIGRDEKPLEQAELQTQSLPWGLFQRLSWPGTELEMS
LSYFNNRTAIVTTKVRNTSGEPQTLTLEWHGAPFDTHNSQPLTLSPQLQKTASGPRLSWS
MLPARDTWNRLIDGASYRLDFEGEREARLEADKGYVVKTDVYLGPGESREYRTAHSYFHT
EQEASAGHFLWADVAPALSANRTRWQHRFDQLVASGDPTLDRAAAKAVMTLAHNWRSAAG
ALQRDAVTPSITYKWFNGVWAWDSWKQAVALARFDTLLAKSNVEAMFDYQFGADDPVRPQ
DAGNLPDAIFYNPGPERGGDGGNWNERNGKPPLAAWAVWEIHAHAPDLDFIKRMYPKLVA
YHSWWYRNRDHNGNGLAEYGANVHPAHVHDGKANPKAILEAAAWESGMDNAPRFDARDTL
NVLENRTADGRLLGYSLSQESVDLNAYLYAEKRLLAKLADALGDEEHAKSWRRDADNLGK
LIREQMWDESTGFFYDLDSLTGKPLLGSGKGVEGWIPLWAGVATQQQAEVMIGRQLSAGT
FGTPIPFPTVSADNPAFAPNKYWRGPVWLDQLYFALAGLERYGAQQQAKTLARRLFTRGE
GILGQSPIRENYQPLTGEGLHATNFSWSASVILLAHQQWLVEAAGQPKPSQAQSTTQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory