Comparing 7022758 FitnessBrowser__ANA3:7022758 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
4isdA Crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione
22% identity, 93% coverage: 1:203/218 of query aligns to 5:185/187 of 4isdA
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
32% identity, 49% coverage: 3:109/218 of query aligns to 4:111/208 of 1fw1A
Sites not aligning to the query:
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
32% identity, 49% coverage: 3:109/218 of query aligns to 8:115/216 of O43708
Sites not aligning to the query:
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
24% identity, 81% coverage: 3:179/218 of query aligns to 5:178/212 of 2cz2A
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
24% identity, 81% coverage: 3:179/218 of query aligns to 8:181/216 of Q9WVL0
P77544 Glutathione S-transferase YfcF; EC 2.5.1.18 from Escherichia coli (strain K12) (see paper)
24% identity, 87% coverage: 10:199/218 of query aligns to 15:206/214 of P77544
Sites not aligning to the query:
4qq7A Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
25% identity, 92% coverage: 1:201/218 of query aligns to 3:194/204 of 4qq7A
6gicB Crystal structure of glutathione transferase omega 2s from trametes versicolor in complex with oxyresveratrol
24% identity, 76% coverage: 9:174/218 of query aligns to 11:172/237 of 6gicB
6gibB Crystal structure of glutathione transferase omega 2s from trametes versicolor
24% identity, 76% coverage: 9:174/218 of query aligns to 11:172/237 of 6gibB
5zwpA Crystal structure of the delta-class glutathione transferase from musca domestica (see paper)
33% identity, 37% coverage: 11:91/218 of query aligns to 8:91/207 of 5zwpA
Sites not aligning to the query:
3bbyA Crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution
23% identity, 87% coverage: 10:199/218 of query aligns to 13:186/191 of 3bbyA
8a0pA Crystal structure of poplar glutathione transferase u20 in complex with morin (see paper)
31% identity, 40% coverage: 24:110/218 of query aligns to 24:112/216 of 8a0pA
Sites not aligning to the query:
8a0rA Crystal structure of poplar glutathione transferase u20 in complex with pinocembrin (see paper)
31% identity, 40% coverage: 24:110/218 of query aligns to 23:111/215 of 8a0rA
Sites not aligning to the query:
8a0qA Crystal structure of poplar glutathione transferase u20 in complex with baicalein (see paper)
31% identity, 40% coverage: 24:110/218 of query aligns to 23:111/215 of 8a0qA
Sites not aligning to the query:
8a0oA Crystal structure of poplar glutathione transferase u20 in complex with galangin (see paper)
31% identity, 40% coverage: 24:110/218 of query aligns to 23:111/215 of 8a0oA
Sites not aligning to the query:
8a0iA Crystal structure of poplar glutathione transferase u20 in complex with glutathionylphenylacetophenone (see paper)
31% identity, 40% coverage: 24:110/218 of query aligns to 23:111/215 of 8a0iA
Sites not aligning to the query:
8a08A Crystal structure of poplar glutathione transferase u20 in complex with glutathione (see paper)
31% identity, 40% coverage: 24:110/218 of query aligns to 23:111/215 of 8a08A
Sites not aligning to the query:
4i97A The crystal structure of glutathione s-transferase sniggstd1a from scaptomyza nigrita in complex with glutathione
31% identity, 37% coverage: 11:91/218 of query aligns to 8:91/207 of 4i97A
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
26% identity, 42% coverage: 3:93/218 of query aligns to 5:94/219 of 3qawA
>7022758 FitnessBrowser__ANA3:7022758
MELYIGNKNYSSWSLRAWLMAEKSGIQFDEILLQLDTESFYQRLKSISPTLKVPTLIDGN
ITVWDSLSICEYINDTYLSGSAWPQDPKQKAKARSFACEMHSGFHALRNALPMNIRAHRY
VELSPAVLQDIARIDSIWSQQMAEFATAQGTWLFGKWSIADMMFAPVVMRFFTYEIEVSQ
ASRAYMEFIVSQPEMQAWIQAAKAETEIVDIDEAGVDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory