Comparing 7022815 FitnessBrowser__ANA3:7022815 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7znpA Structure of amedsp
60% identity, 98% coverage: 1:486/494 of query aligns to 2:493/502 of 7znpA
A0ZZH6 Sucrose phosphorylase; SP; SPase; EC 2.4.1.7 from Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) (see paper)
51% identity, 95% coverage: 1:470/494 of query aligns to 1:471/504 of A0ZZH6
2gduA E232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose (see paper)
51% identity, 95% coverage: 1:470/494 of query aligns to 1:471/504 of 2gduA
5c8bB Structural insights into the redesign of a sucrose phosphorylase by induced loop repositioning (see paper)
51% identity, 95% coverage: 1:470/494 of query aligns to 1:471/504 of 5c8bB
5m9xB Structure of sucrose phosphorylase from bifidobacterium adolescentis bound to glycosylated resveratrol (see paper)
50% identity, 95% coverage: 1:470/494 of query aligns to 1:471/504 of 5m9xB
7xdqA Crystal structure of a glucosylglycerol phosphorylase mutant from marinobacter adhaerens
42% identity, 98% coverage: 1:482/494 of query aligns to 1:466/470 of 7xdqA
D9TT09 Sucrose 6(F)-phosphate phosphorylase; Sucrose 6'-phosphate phosphorylase; SPP; EC 2.4.1.329 from Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIMB 9385 / NCA 3814 / NCTC 13789 / WDCM 00135 / 2032) (Clostridium thermosaccharolyticum) (see 2 papers)
41% identity, 98% coverage: 1:482/494 of query aligns to 3:485/488 of D9TT09
E4PMA5 Glucosylglycerol phosphorylase; GGoP; 2-O-alpha-D-glucopyranosylglycerol:phosphate alpha-D-glucosyltransferase; 2-O-alpha-D-glucosylglycerol phosphorylase (retaining); EC 2.4.1.359 from Marinobacter adhaerens (strain DSM 23420 / HP15) (see paper)
42% identity, 98% coverage: 1:482/494 of query aligns to 3:476/480 of E4PMA5
P10249 Sucrose phosphorylase; Glucosyltransferase-A; GTF-A; Sucrose glucosyltransferase; EC 2.4.1.7 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
41% identity, 93% coverage: 3:459/494 of query aligns to 5:455/481 of P10249
Sites not aligning to the query:
6s9uA Crystal structure of sucrose 6f-phosphate phosphorylase from ilumatobacter coccineus (see paper)
30% identity, 96% coverage: 1:472/494 of query aligns to 6:506/520 of 6s9uA
A0A6C7EEG6 Sucrose 6(F)-phosphate phosphorylase; SPP; Sucrose 6'-phosphate phosphorylase; EC 2.4.1.329 from Ilumatobacter coccineus (strain NBRC 103263 / KCTC 29153 / YM16-304) (see paper)
30% identity, 96% coverage: 1:472/494 of query aligns to 10:510/523 of A0A6C7EEG6
D7BAR0 Glucosylglycerate phosphorylase; GGa phosphorylase; GGaP; EC 2.4.1.352 from Allomeiothermus silvanus (strain ATCC 700542 / DSM 9946 / NBRC 106475 / NCIMB 13440 / VI-R2) (Thermus silvanus) (see paper)
30% identity, 87% coverage: 7:435/494 of query aligns to 54:490/555 of D7BAR0
5gtwA The n253r mutant structures of trehalose synthase from deinococcus radiodurans display two different active-site conformations
23% identity, 49% coverage: 39:281/494 of query aligns to 48:299/548 of 5gtwA
Sites not aligning to the query:
3czkA Crystal structure analysis of sucrose hydrolase(suh) e322q-sucrose complex (see paper)
22% identity, 79% coverage: 37:428/494 of query aligns to 118:542/618 of 3czkA
3uerA Crystal structure of amylosucrase from deinococcus geothermalis in complex with turanose (see paper)
28% identity, 41% coverage: 5:206/494 of query aligns to 97:302/651 of 3uerA
Sites not aligning to the query:
5x7uA Trehalose synthase from thermobaculum terrenum (see paper)
22% identity, 50% coverage: 36:280/494 of query aligns to 46:291/546 of 5x7uA
Sites not aligning to the query:
5ykbD The n253f mutant structure of trehalose synthase from deinococcus radiodurans reveals an open active-site conformation (see paper)
20% identity, 49% coverage: 39:281/494 of query aligns to 48:275/523 of 5ykbD
Sites not aligning to the query:
5jy7B Complex of mycobacterium smegmatis trehalose synthase with maltokinase (see paper)
25% identity, 39% coverage: 40:233/494 of query aligns to 64:256/571 of 5jy7B
Sites not aligning to the query:
3zoaB The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
25% identity, 39% coverage: 40:233/494 of query aligns to 64:256/571 of 3zoaB
Sites not aligning to the query:
3zo9A The structure of trehalose synthase (tres) of mycobacterium smegmatis (see paper)
25% identity, 39% coverage: 40:233/494 of query aligns to 52:244/549 of 3zo9A
Sites not aligning to the query:
>7022815 FitnessBrowser__ANA3:7022815
MKNQVQLITYVDRITGAGLKQLKALLDNELDGLFGGVHLLPFYYPIDGSDAGFDPIDHVQ
VDSRLGDWDDVKSIGEAFDIMADLIVNHMSAESPEFKDVLKHGKQSVYWDLFLTKDKVFP
EGLSEQDQKAIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQIDIDVNSAAGKDYLNRVLA
RFNHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQANELGMTTLAEIHSHHMT
QIDIAKRVDMVYDFALPPLILHTLFSQDCSALSHWLDMAPRNCITVLDTHDGIGIIDVGP
MDGLRGLLNEKQIDNLVETIHGNSQGESLQATGAAASNVDLYQINCTYYDALGQNDLDYL
MARAIQFFAPGIPQVYYTGLLAIPNDMTLLNQTHVGRDINRPYLNREKVQQALQKPVVKA
LIQLIKLRNNSAAFNGRFSMAASGKTLTLTWSAQNASASLSLDFAHKQGLITLLDEQGIE
TQIALADLLTQAQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory